Identifiers and Description

Gene Model Identifier

TTHERM_00190830

Standard Name

DRH1 (DExD/H box RNA helicase 1)

Aliases

PreTt08734 | 15.m00445 | 3697.m00156

Description

P68-like protein, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR00643 ) ATP-dependent DNA helicase RecG
  • ( TIGR01389 ) ATP-dependent DNA helicase RecQ
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 17.2%

TetraMine Data

TTHERM_00190830

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD01850 ) Macronucleus: Neo3 cassette replaces part of 5’ end of coding
  • ( SD01851 ) Macronucleus: Neo3 cassette replaces part of 5’ end of coding
  • ( SD01944 ) Micronucleus: neo4 Macronucleus: neo4
  • ( SD01945 ) Micronucleus: Neo4 into 5’ end of coding of DRH1 Macronucleus: Neo4 into 5’ end of coding of DRH1
  • ( SD02139 ) Micronucleus: Neo4 into 5’ end of coding of DRH1
  • ( SD02140 ) Micronucleus: Neo4 into 5’ end of coding of DRH1
  • ( SD02141 ) Micronucleus: Neo4 into 5’ end of coding of DRH1
  • ( SD02142 ) Micronucleus: Neo4 into 5’ end of coding of DRH1
  • ( SD02594 ) Macronucleus: Neo3 cassette replaces part of 5’ end of coding
  • ( SD02595 ) Macronucleus: Neo3 cassette replaces part of 5' end of coding
  • ( SD02596 ) Macronucleus: Neo3 cassette replaces part of 5’ end of coding
  • ( SD02597 ) Macronucleus: Neo3 cassette replaces part of 5’ end of coding
  • ( Micronucle ) Micronucleus: neo4 Macronucleus: neo4
  • ( SD02598 ) Micronucleus: neo4 Macronucleus: neo4
  • ( SD02599 ) Micronucleus: neo4 at 5’ end of coding, some coding remains Macronucleus: neo4 at 5’ end of coding, some coding remains

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06214.19.997093137033517e-262P68-like protein (718 aa)
OxytrichaContig21312.0.g806.002069467939404e-154DEAD/DEAH box helicase
SGDYNL112W4.000899569014317e-153DBP2 Essential ATP-dependent R
NA helicase of the DEAD-box pr
otein family, involved in nons
ense-mediated mRNA decay and r
RNA processing
DictyBaseDDB_G02931689.003323285460187e-148ddx17 on chromosome: 6 positio
n 2360817 to 2364250
WormBaseWBGene000102602.0000211193600847e-137locus:ddx-17 status:Confirme
d UniProt:Q9XUW5 protein_i
d:CAB04518.1
Stentor CoeruleusSteCoe_126035.96629836401057e-72

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27793833: McDaniel SL, Zweifel E, Harris PK, Yao MC, Cole ES, Chalker DL (2016) DRH1, a p68-related RNA helicase gene, is required for chromosome breakage in Tetrahymena. Biology open 5(12):1790-1798

Sequences

>TTHERM_00190830(coding)
ATGATTAACTTATTAAAAATTAGTAGTAAGACTAAGTTAATTAGTAGTTTGAGCTCAAGT
GCTTCTGCATTTAAAATAATCAAACAAAATTCTGAAAATTTATAATTTCAAAAACTAATA
ACCAAATAATTATATCAAATGTCAAGATAAATCTAAAGCAATTCTAATAAGGGAGAAGGC
TCAGACTATGAGAGTCATCAAAGCTCCGACAACCAACAGAAATAAGGAAATGGCTACTTC
AATAACAGAAATGTCAATGGCCAAAATTAAAATGGCTACTAAAGCAATGGCTATAACAAT
AGAGGTGGATATCAAAAGAGCTACGGAACAAACAAGTACAATAACGGAAATGGCTATGGT
AACTCCAATGGTGGCTACTTCAATAACAACAATAAACCAAATGGATACTTCAATGCCAAT
AAAAAGTTTGGAAATGAAGAGCAAAAAACTAACGTAGATAATCAAAAACCTTACGGATAC
AACTAATAAAATAACAACTAGTCTAATAAGGACTTGAATAACAGCGGCTACAGTGATGAA
AATCACTTAGGTGAAAATTTACACGATATTGACTACACAAAGGTCGAGCTCAAGCCTTTC
TAAAAGGTTTTCTACTAAGTTGGTAAATCAATACATACTGATGAAGAAATTGCTACCTAC
TAAAGAGAGAAGGGTATTATAATCCGTTCAAAGCACAAAGAGGTTCCCTAACCTTTCATA
AAATGGAACGAAACCAAATTCCCCAAATATATTATGTCCGTAATAGAAGACAGCAAATTC
TCTGAACCTATGCCCATCTAAGCTCAGTCTTTCCCTATTGTGTTGAGTGGTCATGACTTG
ATAGGTATTGCTTAAACTGGTTCAGGAAAAACTCTTTCTTTCATGCTTCCTGCTCTTGTT
CATATTAATGCCCAAGATCCCGTAAAGCCAGGCGAAGGCCCTATTGCATTAGTTTTGGCT
CCAACCAGAGAATTGGCAAACTAAATATAAGAACAATGCTTCAAATTTGGCAGCAAATGC
AAAATTAGCAGTGTTTGTGTTTATGGTGGTGCCCCTAAGATTTACCAAGAAAAGGAACTC
CGTAATGGCTGCGATATTGTCATTGCTACTCCTGGTAGACTCATTGATTTCTTGGAAAGT
AATGTTATCGACTTGAAGAGAGTAACTTATCTTGTTCTCGATGAAGCCGATAGAATGCTT
GATATGGGTTTTGAACCTTCCATCAGAAAAATCGTTGGCTAAATCAGACCTGATAGATAA
ACTCTTATGTTCTCTGCTACTTGGCCTTAAACTGTTAGAAGACTTGCCCTTGATTTTTGT
CATGGAGATCCTATTCACATTCAAATTGGTGATATGGAAAACAACGTCAACAATGATATC
GATCAATAAGTTGAAATCATTGATAAAAGCCAAAAATACGATAGAGTTAAAGAAATTCTT
AGCACAATGACAAGATCTGATAAGACCATTATCTTTACTTAAACAAAGAAAGATTGTGAT
GATCTTAGCAAAGCTCTCTAAACTGACAATATAAGAAACATCTGTATCCATGGTGATAAA
TCCCAAAGAGATAGAGATAAAGTTATGGACCTCTTCAAAACTGGTAGAGTCAACACTTTA
ATTGCAACCGATGTTGCATCTAGAGGTCTTGATGTCAAGGACATTAAATTAGTTATTAAC
TATGATTTCCCTAAGCAAATCGAAGACTACGTACATAGAGTCGGTAGAACTGGAAGAGCA
GGTGCTTAAGGTAAAGCTATTTCATTCCTTGATCAATATGAAGACAAGAAGATTTCTAAG
GAATTAGTTGATGTCTTGAAGTAAAATAATTAAGAAATTAGTCAAGATCTTCTTGAACTC
TCTGAAGCAAACTACAAGGGTAATTACAGTAATAACTATAATAAGAACAGAAGTAGCAAG
CCTTACAGTGGTGGATACAATAATAACAGAAACTATTATGGAAATAATAACGAAATGGGT
TTCAGAAACAGCAATAATGGATTCTCTAACAATGGCTACCAAAATGGTAACAGCAACGGA
GGTTATAGAAGCCAATAGAACAATAATGGGTTCCAAAATAATAACTATAACCGTGACTTC
CCTAAGAGATAGGAAGATGGCAACGGTGGTTCTGAACAACCTAAGAAATTCGGTTTCTTC
AACCCAAAGAAAGACAACTGA


>TTHERM_00190830(protein)
MINLLKISSKTKLISSLSSSASAFKIIKQNSENLQFQKLITKQLYQMSRQIQSNSNKGEG
SDYESHQSSDNQQKQGNGYFNNRNVNGQNQNGYQSNGYNNRGGYQKSYGTNKYNNGNGYG
NSNGGYFNNNNKPNGYFNANKKFGNEEQKTNVDNQKPYGYNQQNNNQSNKDLNNSGYSDE
NHLGENLHDIDYTKVELKPFQKVFYQVGKSIHTDEEIATYQREKGIIIRSKHKEVPQPFI
KWNETKFPKYIMSVIEDSKFSEPMPIQAQSFPIVLSGHDLIGIAQTGSGKTLSFMLPALV
HINAQDPVKPGEGPIALVLAPTRELANQIQEQCFKFGSKCKISSVCVYGGAPKIYQEKEL
RNGCDIVIATPGRLIDFLESNVIDLKRVTYLVLDEADRMLDMGFEPSIRKIVGQIRPDRQ
TLMFSATWPQTVRRLALDFCHGDPIHIQIGDMENNVNNDIDQQVEIIDKSQKYDRVKEIL
STMTRSDKTIIFTQTKKDCDDLSKALQTDNIRNICIHGDKSQRDRDKVMDLFKTGRVNTL
IATDVASRGLDVKDIKLVINYDFPKQIEDYVHRVGRTGRAGAQGKAISFLDQYEDKKISK
ELVDVLKQNNQEISQDLLELSEANYKGNYSNNYNKNRSSKPYSGGYNNNRNYYGNNNEMG
FRNSNNGFSNNGYQNGNSNGGYRSQQNNNGFQNNNYNRDFPKRQEDGNGGSEQPKKFGFF
NPKKDN


>TTHERM_00190830(gene)
TTACCAAAATTAAAGAAATATATAATTTAGAAGAAAAATTAAAAAGTTATAAGTTTTCTG
CATCAATAGTTAGCTAGTGCACGAGAGAGAAATTTTGAAAGAGGAATAGAAGAAGAAAAT
AAGAATATATATATATATATGATTAACTTATTAAAAATTAGTAGTAAGACTAAGTTAATT
AGTAGTTTGAGCTCAAGTGCTTCTGCATTTAAAATAATCAAACAAAATTCTGAAAATTTA
TAATTTCAAAAACTAATAACCAAATAATTATATCAAATGTCAAGATAAATCTAAAGCAAT
TCTAATAAGGGAGAAGGCTCAGACTATGAGAGTCATCAAAGCTCCGACAACCAACAGTAA
GCATTTCAGTATTTTCTTTCATAGCAACTTACATCCATAGCTTAAAATTTCATATTATGT
CTAAGCTACTCCAAAGGAAAACTAACTCTTTTTTACTAAGCAAGCTATGAAATCTTCATG
ATTTTAAAAATCTAAAAAATAAGGAGATATGAAAAAAAAATCAAGAATACATTCTCTAAA
ATAGTTTTTATCACAATAAATTCCAATGATTTCATCTATAATTTAGAATTAACAACAGAA
AATCTATCTAATTTAAGCAGTTGGATGAAGAGTTTTTTGTTTGGAGCAGATATTTTGCTT
TTTATTTTCTGACAAAACCATTCATTAACACAATATTATAAATTATAAAGGAAATAAGGA
AATGGCTACTTCAATAACAGAAATGTCAATGGCCAAAATTAAAATGGCTACTAAAGCAAT
GGCTATAACAATAGAGGTGGATATCAAAAGAGCTACGGAACAAACAAGTACAATAACGGA
AATGGCTATGGTAACTCCAATGGTGGCTACTTCAATAACAACAATAAACCAAATGGATAC
TTCAATGCCAATAAAAAGTTTGGAAATGAAGAGCAAAAAACTAACGTAGATAATCAAAAA
CCTTACGGATACAACTAATAAAATAACAACTAGTCTAATAAGGACTTGAATAACAGCGGC
TACAGTGATGAAAATCACTTAGGTGAAAATTTACACGATATTGACTACACAAAGGTCGAG
CTCAAGCCTTTCTAAAAGGTTTTCTACTAAGTTGGTAAATCAATACATACTGATGAAGAA
ATTGCTACCTACTAAAGAGAGAAGGGTATTATAATCCGTTCAAAGCACAAAGAGGTTCCC
TAACCTTTCATAAAATGGAACGAAACCAAATTCCCCAAATATATTATGTCCGTAATAGAA
GACAGCAAATTCTCTGAACCTATGCCCATCTAAGCTCAGTGTAAATATTTTTATAAATTG
AATTTCTTTCTCTATGACATTAGTTTGATAGACACTTGAAAATTTTTGTCAAGATGTTAC
AAACAAGAAATAGAAGAAAAAGTATAAAATGTATGAATGTTCCTTCATACGTACTACGAT
AATTAAATGAATCAAAATTTGATTTAAATTGCAATGAAATTAAATCATTCAAACAAACTA
CGCTCATAAGTGATTAAATAAATGAGTATTTTATCTTTGATTTTATTAATTAGTCACTAA
ATTTATCTATGACTCACTTAATCAATCAATCAATCGCTTAGAGAAAATTTTTTATCTCCC
ACCTTTAAATAAATAAATAATTAGCGTGTTAGATAAAAATTGATTTCAAACACAAATAAA
TCATATTTCCAATATTTAATTTTTCCTCTGAAAATTAATAATTTTGCATTCTCTTTATTT
TCAAATTAATTATTTTATATGCATTAATTATGAAACTAAGAAAATTGAATATGTAGCTAA
ATTTTCTTTTTCCCAACTACAAATTAATTAATTAATTAATTAAATTTTAAAACCCATTTT
ATACATCCCATTTTTTTGACAGATTTAAATATTTTTGATACTAAAATTAGTATTTTAATA
TATTTGTTTATTCATTCATAAATTAATTAATAATCACTCTATAATATAGCTTTCCCTATT
GTGTTGAGTGGTCATGACTTGATAGGTATTGCTTAAACTGGTTCAGGAAAAACTCTTTCT
TTCATGCTTCCTGCTCTTGTTCATATTAATGCCCAAGATCCCGTAAAGCCAGGCGAAGGC
CCTATTGCATTAGTTTTGGCTCCAACCAGAGAATTGGCAAACTAAATATAAGAACAATGC
TTCAAATTTGGCAGCAAATGCAAAATTAGCAGTGTTTGTGTTTATGGTGGTGCCCCTAAG
ATTTACCAAGAAAAGGAACTCCGTAATGGCTGCGATATTGTCATTGCTACTCCTGGTAGA
CTCATTGATTTCTTGGAAAGTAATGTTATCGACTTGAAGAGAGTAACTTATCTTGTTCTC
GATGAAGCCGATAGAATGCTTGATATGGGTTTTGAACCTTCCATCAGAAAAATCGTTGGC
TAAATCAGACCTGATAGATAAACTCTTATGTTCTCTGCTACTTGGCCTTAAACTGTTAGA
AGACTTGCCCTTGATTTTTGTCATGGAGATCCTATTCACATTCAAATTGGTGATATGGAA
AACAACGTCAACAATGATATCGATCAATAAGTTGAAATCATTGATAAAAGCCAAAAATAC
GATAGGTAAATAATAATTATTACTTAAATTTGACACATTATAATATCTAATTTATCATAA
AGAGTTAAAGAAATTCTTAGCACAATGACAAGATCTGATAAGACCATTATCTTTACTTAA
ACAAAGAAAGATTGTGATGATCTTAGCAAAGCTCTCTAAACTGACAATATAAGAAACATC
TGTATCCATGGTGATAAATCCCAAAGAGATAGAGATAAAGTTATGGACCTCTTCAAAACT
GGTAGAGTCAACACTTTAATTGCAACCGATGTTGCATCTAGAGGTCTTGATGTCAAGGAC
ATTAAATTAGTTATTAACTATGATTTCCCTAAGCAAATCGAAGACTACGTACATAGAGTC
GGTAGAACTGGAAGAGCAGGTGCTTAAGGTAAAGCTATTTCATTCCTTGATCAATATGAA
GACAAGAAGATTTCTAAGGAATTAGTTGATGTCTTGAAGTAAAATAATTAAGAAATTAGT
CAAGATCTTCTTGAACTCTCTGAAGCAAGTAATTAATAACTTTAATTAATTTTCACCATC
ATTTATATTTATTTTCACAATTGAAAAGTTAAATATTTATTTATTCATATATTTTCCTCT
AAAAAAAAAGACTACAAGGGTAATTACAGTAATAACTATAATAAGAACAGAAGTAGCAAG
CCTTACAGTGGTGGATACAATAATAACAGAAACTATTATGGAAATAATAACGAAATGGGT
TTCAGAAACAGCAATAATGGATTCTCTAACAATGGCTACCAAAATGGTAACAGCAACGGA
GGTTATAGAAGCCAATAGAACAATAATGGGTTCCAAAATAATAACTATAACCGTGACTTC
CCTAAGAGATAGGAAGATGGCAACGGTGGTTCTGAACAACCTAAGAAATTCGGTTTCTTC
AACCCAAAGAAAGACAACTGA