Identifiers and Description

Gene Model Identifier

TTHERM_00825510

Standard Name

DRB2 (Double-stranded RNA Binding 2)

Aliases

PreTt04015 | 142.m00112 | 3683.m00045

Description

Double-stranded RNA binding motif family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF02178 ) AT hook motif
  • ( PF08945 ) Bcl-x interacting
  • ( PF00249 ) Myb-like DNA-binding domain
  • ( PF08025 ) Spider antimicrobial peptide
  • ( PF00035 ) Double-stranded RNA binding motif
  • ( PF01402 ) Ribbon-helix-helix protein, copG family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00825510

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18269.19.997093137033517e-262double-stranded RNA binding do
main-containing protein family
protein (964 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26769902: Woo TT, Chao JL, Yao MC (2016) Dynamic distributions of long double-stranded RNA in Tetrahymena during nuclear development and genome rearrangements. Journal of cell science 129(5):1046-58
  2. Ref:22021239: Motl JA, Chalker DL (2011) Zygotic expression of the double-stranded RNA binding motif protein Drb2p is required for DNA elimination in the ciliate Tetrahymena thermophila. Eukaryotic cell 10(12):1648-59

Sequences

>TTHERM_00825510(coding)
ATGGCGCAATCTTTTAGATTTATAGACTAAGAAACATAAGATTTTTTAATGGAGTTTTCT
GATCTTTAAAATAATGAAGTAGTGTAAAAATTATAAAAAGATCAGATGAAACTTCTTCAG
TTAAAAAATAATTTAAATAATATTGCTAATTGTGCATCTATTAATCCAACAAAAAAATCT
TAAGAAGTTATTTATTAAAATGCTTAATAAACAAATAATTTTTAGTAAGATTAGCAAAGT
TTTAATGATAAAAATGCTAATTTTTAAGGAAATAATTTTAATGGAAATTTATATTTTTAG
TAGAATTACAAGAATGGTAATTAAGAATAATAAAGCATAAATGATTCGTATATTATTGAT
AAAAAATAAAATAGTATTCGTGCTGAATAAGGAGAATAAAAAAGGGAAAAAGAAAACGAA
ATAGTAAAATATTAATTCAAAGAACTAAAAAAAAAAATGATTTAAAGAAGCTAAGACTAG
ATAATAGATGAAATATACAAGCATTAAAAGTAATTGATTTTGAAAGAAGCAACAGATAGG
CTTGATAAAGAAGATCCTTCATAAAAAAGTGAGCAAAATTGTTAACAAACAATTCAATAA
AATAATAGCCTTGAAGATTAAGATAAATTTAATTATTCAGTTAATAATGGATAGGCTATG
AATCATTAAAGATAATAAAAATAAGATATTTTAAGAATGTTGAATCCTCCTAATTATTTA
AAATAAAAATGGAATATAATATAAAAAGGCATTGAAGATCGTTTAATAACTCACAATGAA
GATGGACTTCCTAAAAATTTAAATCCTATAGAAAAGAGTATTTTAAAAGAAAAAGAAAAT
GGCTACAAGCTGCTCAAACCTGAAGGTGAAATAGGAGAACTTGAATAGCAAGAAGAAGAA
GAAGATGAAGAAAATATGAGCAACGAAGTCTTAATAACAAGAAAAATTGTTAAAATACTT
GAAGAATTCAAAGAAGTTTAAAAAAGAGATTAAGATTCAATATTTCATATTGCTTTGAAA
TAGTATTGTGAGAAATTTCATAAAAACTATGATTGTGTCTTTACAGAGGAGAAGGATTCG
AAGTTAAAAGGTTTTATTTGTGAAGTTATTGTTGATGGTATTAGATTAGGTCCTTAATTA
GCTAAATCTAAAAAAGATGCTAAGACATAGGCTTGTATGTGTGCTATGGCTAGAATTATG
CAATAATCTCCAAATATGAAACCTATCGAGTATTTTTAAAAATTCTTAGAATAGTCGAAA
AATAAATACATAAGATTAAATGAGAATATAGCTGAAGCTATTTCATAGCATCATTAGTAA
GGAGGAGTTCCTTTATCTGCAGATAATCCATTAAGTGATCTTGCCATTGCTTAAGAGATT
CCTGAAAATTCTAATTATAGAGAGGAATTGTCAATCTTTGCTCATAAAAATTTACATAAA
TAAATAATTTGGGAGACTTTATTTGATCCTAAAGAAAAGTTATGGCTGGCCATAGTAGCT
GTTGGTAATTTGTCAGAAAGAGGATTTGGTAGAAGTAAAAAATACGCTAAAAATGTTGCA
TCATATAAGTTATTGCAAAGATGCAAGCAGTTAAAAATGAAAGATGATATTTTTAAAAAT
CCAAGAAAAGTTAAAACTTAATTGCAGTTTGCTTTAAATTTAGAATAAAACGAAGATGAA
GAAAATATCAAACAACAAAACAGCCTTATAAAAATTAAGTAAAGTGGAAAATAAAATGAA
TAAATTAATTCTAAAAGATTAAGGTCATAAGTAGAAGATTTAGAAAATGATTTAGATTAA
GAAGATGAAGAGTAAGAATAAGAACCAGATTTAAAAAAATAACAGCAATAATAATAATAA
ATATAATAATAGCAGCAATAGCCAAACACAAAGAGTGTAGCACAAATAAAAATGAAAGAA
TTAATTATATCTTTAGAAGAAAAATATATTGATTATTACAAGTTAGAACTATCCTCTAAC
TTAAATTAATCTAAAATAAATAATGCCTCGAATACAGATGTCTTTAAGTAACTTTTAAAA
TACGATTCAGAGATTTAAGCAACAAAAGCCTAGTATTAATCTTTGCAAAATATGTTTAAC
GAAGTATAGAAAAAGCTTTTGATTGATCAATAATCTTAATATATCAAAAAATTGATTCCT
ATAGGGTCTTATGTAAGTAATTGTATGAATAAATATTCAACAGTTATGGATGTTGTAGCC
TTATTGATGCCTTCATAAGAATAGGGAGAAAATTTTGAACCTAATCGCTTTTGTGATATA
CTTTACAGTGAAGTTTAGTCTACTATCTTAAACAGTAACATTGGATACTTTTTTAAAATG
GAATTGAACAAAGGTTGTGTTTTACTAGTATTTACTCACAATTCTTAATATAAAATCAGA
CTTATACCTAATTTAGTATTAGAAGAAAATATTTTGAATAAAAGAAAATATTTATAGTAA
ACTGAAAATCCTTTAAATGACTCAATTAAAACCATAATAGATCCAAATGAAAGTTAATTT
TATAGTGATGGTTTATTGCATTACATTTGGCTAAGCTAATTCAAATCATAAATCCATTAG
TATGAGAGCTTATTTAGAATTTTAAGAAGAGTCTTTAAATATTAAGGATTCAGAGTACCT
ATAGATTTAATAGATGTTGTAGTCGGACACGTCAGCCATCAATTTAGTTCTGCATCATTT
TAAGAAAATATAGTGGGATTTGTAAAATTTATGGCATAAAATGGCTTAGATGATATTACA
CATGATAATCTATAAATGGTCTCTATTACTTAGCTTCATGTTAATTAAATTAAAAGTTGT
TCTGAATTTGAACTTAAAAAAATAACAGAATACTTTAACAGCATTTATACAAAAAAAGCT
TATGATAACTTAATAATTATTTGA


>TTHERM_00825510(protein)
MAQSFRFIDQETQDFLMEFSDLQNNEVVQKLQKDQMKLLQLKNNLNNIANCASINPTKKS
QEVIYQNAQQTNNFQQDQQSFNDKNANFQGNNFNGNLYFQQNYKNGNQEQQSINDSYIID
KKQNSIRAEQGEQKREKENEIVKYQFKELKKKMIQRSQDQIIDEIYKHQKQLILKEATDR
LDKEDPSQKSEQNCQQTIQQNNSLEDQDKFNYSVNNGQAMNHQRQQKQDILRMLNPPNYL
KQKWNIIQKGIEDRLITHNEDGLPKNLNPIEKSILKEKENGYKLLKPEGEIGELEQQEEE
EDEENMSNEVLITRKIVKILEEFKEVQKRDQDSIFHIALKQYCEKFHKNYDCVFTEEKDS
KLKGFICEVIVDGIRLGPQLAKSKKDAKTQACMCAMARIMQQSPNMKPIEYFQKFLEQSK
NKYIRLNENIAEAISQHHQQGGVPLSADNPLSDLAIAQEIPENSNYREELSIFAHKNLHK
QIIWETLFDPKEKLWLAIVAVGNLSERGFGRSKKYAKNVASYKLLQRCKQLKMKDDIFKN
PRKVKTQLQFALNLEQNEDEENIKQQNSLIKIKQSGKQNEQINSKRLRSQVEDLENDLDQ
EDEEQEQEPDLKKQQQQQQQIQQQQQQPNTKSVAQIKMKELIISLEEKYIDYYKLELSSN
LNQSKINNASNTDVFKQLLKYDSEIQATKAQYQSLQNMFNEVQKKLLIDQQSQYIKKLIP
IGSYVSNCMNKYSTVMDVVALLMPSQEQGENFEPNRFCDILYSEVQSTILNSNIGYFFKM
ELNKGCVLLVFTHNSQYKIRLIPNLVLEENILNKRKYLQQTENPLNDSIKTIIDPNESQF
YSDGLLHYIWLSQFKSQIHQYESLFRILRRVFKYQGFRVPIDLIDVVVGHVSHQFSSASF
QENIVGFVKFMAQNGLDDITHDNLQMVSITQLHVNQIKSCSEFELKKITEYFNSIYTKKA
YDNLIII


>TTHERM_00825510(gene)
TAAAATCTAAAATAATCAAAATTTCAAAATTAAATTTTAAAAATTTCAAAATCAACACAG
ATTAAATAAATACTAAAGTTAATGGCGCAATCTTTTAGATTTATAGACTAAGAAACATAA
GATTTTTTAATGGAGTTTTCTGATCTTTAAAATAATGAAGTAGTGTAAAAATTATAAAAA
GATCAGATGAAACTTCTTCAGTTAAAAAATAATTTAAATAATATTGCTAATTGTGCATCT
ATTAATCCAACAAAAAAATCTTAAGAAGTTATTTATTAAAATGCTTAATAAACAAATAAT
TTTTAGTAAGATTAGCAAAGTTTTAATGATAAAAATGCTAATTTTTAAGGAAATAATTTT
AATGGAAATTTATATTTTTAGTAGAATTACAAGAATGGTAATTAAGAATAATAAAGCATA
AATGATTCGTATATTATTGATAAAAAATAAAATAGTATTCGTGCTGAATAAGGAGAATAA
AAAAGGGAAAAAGAAAACGAAATAGTAAAATATTAATTCAAAGAACTAAAAAAAAAAATG
ATTTAAAGAAGCTAAGACTAGATAATAGATGAAATATACAAGCATTAAAAGTAATTGATT
TTGAAAGAAGCAACAGATAGGCTTGATAAAGAAGATCCTTCATAAAAAAGTGAGCAAAAT
TGTTAACAAACAATTCAATAAAATAATAGCCTTGAAGATTAAGATAAATTTAATTATTCA
GTTAATAATGGATAGGCTATGAATCATTAAAGATAATAAAAATAAGATATTTTAAGAATG
TTGAATCCTCCTAATTATTTAAAATAAAAATGGAATATAATATAAAAAGGCATTGAAGAT
CGTTTAATAACTCACAATGAAGATGGACTTCCTAAAAATTTAAATCCTATAGAAAAGAGT
ATTTTAAAAGAAAAAGAAAATGGCTACAAGCTGCTCAAACCTGAAGGTGAAATAGGAGAA
CTTGAATAGCAAGAAGAAGAAGAAGATGAAGAAAATATGAGCAACGAAGTCTTAATAACA
AGAAAAATTGTTAAAATACTTGAAGAATTCAAAGAAGTTTAAAAAAGAGATTAAGATTCA
ATATTTCATATTGCTTTGAAATAGTATTGTGAGAAATTTCATAAAAACTATGATTGTGTC
TTTACAGAGGAGAAGGATTCGAAGTTAAAAGGTTTTATTTGTGAAGTTATTGTTGATGGT
ATTAGATTAGGTCCTTAATTAGCTAAATCTAAAAAAGATGCTAAGACATAGGCTTGTATG
TGTGCTATGGCTAGAATTATGCAATAATCTCCAAATATGAAACCTATCGAGTATTTTTAA
AAATTCTTAGAATAGTCGAAAAATAAATACATAAGATTAAATGAGAATATAGCTGAAGCT
ATTTCATAGCATCATTAGTAAGGAGGAGTTCCTTTATCTGCAGATAATCCATTAAGTGAT
CTTGCCATTGCTTAAGAGATTCCTGAAAATTCTAATTATAGAGAGGAATTGTCAATCTTT
GCTCATAAAAATTTACATAAATAAATAATTTGGGAGACTTTATTTGATCCTAAAGAAAAG
TTATGGCTGGCCATAGTAGCTGTTGGTAATTTGTCAGAAAGAGGATTTGGTAGAAGTAAA
AAATACGCTAAAAATGTTGCATCATATAAGTTATTGCAAAGATGCAAGCAGTTAAAAATG
AAAGATGATATTTTTAAAAATCCAAGAAAAGTTAAAACTTAATTGCAGTTTGCTTTAAAT
TTAGAATAAAACGAAGATGAAGAAAATATCAAACAACAAAACAGCCTTATAAAAATTAAG
TAAAGTGGAAAATAAAATGAATAAATTAATTCTAAAAGATTAAGGTCATAAGTAGAAGAT
TTAGAAAATGATTTAGATTAAGAAGATGAAGAGTAAGAATAAGAACCAGATTTAAAAAAA
TAACAGCAATAATAATAATAAATATAATAATAGCAGCAATAGCCAAACACAAAGAGTGTA
GCACAAATAAAAATGAAAGAATTAATTATATCTTTAGAAGAAAAATATATTGATTATTAC
AAGTTAGAACTATCCTCTAACTTAAATTAATCTAAAATAAATAATGCCTCGAATACAGAT
GTCTTTAAGTAACTTTTAAAATACGATTCAGAGATTTAAGCAACAAAAGCCTAGTATTAA
TCTTTGCAAAATATGTTTAACGAAGTATAGAAAAAGCTTTTGATTGATCAATAATCTTAA
TATATCAAAAAATTGATTCCTATAGGGTCTTATGTAAGTAATTGTATGAATAAATATTCA
ACAGTTATGGATGTTGTAGCCTTATTGATGCCTTCATAAGAATAGGGAGAAGTAACATTT
TTATTAATTTAAAAAAATAATTTTAAAAAAATTTATTTATTATTTCTATTTAGAATTTTG
AACCTAATCGCTTTTGTGATATACTTTACAGTGAAGTTTAGTCTACTATCTTAAACAGTA
ACATTGGATACTTTTTTAAAATGGAATTGAACAAAGGTTGTGTTTTACTAGTATTTACTC
ACAATTCTTAATATAAAATCAGACTTATACCTAATTTAGTATTAGAAGAAAATATTTTGA
ATAAAAGAAAATATTTATAGTAAACTGAAAATCCTTTAAATGACTCAATTAAAACCATAA
TAGATCCAAATGAAAGTTAATTTTATAGTGATGGTTTATTGCATTACATTTGGCTAAGCT
AATTCAAATCATAAATCCATTAGTATGAGAGCTTATTTAGAATTTTAAGAAGAGTCTTTA
AATATTAAGGATTCAGAGTACCTATAGATTTAATAGATGTTGTAGTCGGACACGTCAGCC
ATCAATTTAGTTCTGCATCATTTTAAGAAAATATAGTGGGATTTGTAAAATTTATGGCAT
AAAATGGCTTAGATGATATTACACATGATAATCTATAAATGGTCTCTATTACTTAGCTTC
ATGTTAATTAAATTAAAAGTTGTTCTGAATTTGAACTTAAAAAAATAACAGAATACTTTA
ACAGCATTTATACAAAAAAAGCTTATGATAACTTAATAATTATTTGA