Identifiers and Description

Gene Model Identifier

TTHERM_00078870

Standard Name

DRB1 (double-stranded RNA binding protein 1)

Aliases

PreTt10133 | 5.m00484 | 3828.m01396

Description

Double-stranded RNA binding motif family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF00035 ) Double-stranded RNA binding motif

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00078870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07047.19.997093137033517e-262double-stranded RNA binding do
main-containing protein family
protein (753 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26769902: Woo TT, Chao JL, Yao MC (2016) Dynamic distributions of long double-stranded RNA in Tetrahymena during nuclear development and genome rearrangements. Journal of cell science 129(5):1046-58
  2. Ref:22021239: Motl JA, Chalker DL (2011) Zygotic expression of the double-stranded RNA binding motif protein Drb2p is required for DNA elimination in the ciliate Tetrahymena thermophila. Eukaryotic cell 10(12):1648-59

Sequences

>TTHERM_00078870(coding)
ATGAATTCTTAGCAAGAGTTGTACAACTTAAACAGCTTTTAAAATTACTAAAACATGAAT
TAGTATCCCTAAAATTACCCATACTATTCAAATAATTAAATTATTCACCCTTCTTAAACA
GCAAATATGAATAATTCTGCAGGAATGCAATACATTAATCATGAATAAAACTATCCTTAA
TACCAGTAGTAGAGTTTTAACTAACAGAATTATTATCATCAAGAAGCAGCTTAATACCAA
AATCAAAATATGTTTTAAGTACCTCCATAACAGGTTAATCCTTACATGGGCTATTAAAAT
AATCCTCCTATAAATCAAAATGTCAATAACTTAAATTAGAACAACTTATTACAAGATTAA
TACAAAAGAAGTGAGACACAATCTAACTTTTAAAACTCTTACAACTATAGTCAGCAACAG
CAACATGATATTGACCCATCTACTATAGGCATAGATTAATAACTCTAAACAGTTAAAGAC
AAAGAAGAAATCAATTTAAAAACCCTTAACAAAAAAAGAAAATAGCAAGAAATTCAAGAA
TGTTTAATAGATTAAAATAAAAATGATGATTAGTCTCCATAAAAATAAGATAAAAACGAA
AACAATTTTGTATAAAACTTGATGGACGACATTTAACTTTATTTTCCTTAAAAACCTTTA
AGTGTGTTTCTTAGAGAATACTGCTCTAAAATGAAAAGAGCAATGGATATTATTTGTGAT
GAGAACGAAAAGGGGTTAGGGTTTTCTAGCTATTTAATAATTGATGGCAAACACTATCCA
AAAGGTATAGGAAAAAGTAAAAAAGATGCTAGAGAAGAAGCTTCTATGAATGCATTAGCT
AAAATGGGCGAAGAAAACAGCTCAGTAAAAAATTACTTTGCTGTGATGGTAGATAAAGAA
AAGAAAGTTCATCAAAAATTTAAAAACGAGAAGGCAAAATCTTCAAGTTCTGAGTAAAAA
AGCAAATCAAAAGACATATCTGAAGAGGAGGAGCGAGCTCTGGAGCTTTATGATCCACTC
CATAACTACAGAGAAGATGTTTCATAATTAGCCAATTAGGTCTTAAGATTATCTGTTTCT
TATGAGACATTAGGAGATTAAAATAATTGGGAGGTTATCTGTTCTATTGGAAAATCACTG
AAAACGATGGGATAAGGGTTGACTATAAAAGATGCTAAAAACATTTCAGCTTACAAAATG
ATTCATTTAATAGAGCAATCAAATGAAAAAACGATAAAAACGTTAGCCCGAAAAGCTCTA
GTTTAATAGAAAATAGATTAGACCAACTTAAAGCTTAAAGAATTATAGGAGTTGAAAGCT
CAAAAAGAAAAAGATGAATAAAATACTCAGATAAAAGAAATCTAAAAAGAGCAAGAAAAT
CTTGAAAAAGAAAACAAATAACATTAATAATCTCTCTTAAATACTTATTCCTGCTTAATA
GACTCTAATTATGAAAAACCTTAAGAACTATAAAAACCAAAAATTAAGTCTCAGTAAAGC
ATTATAAGTAGCTGTTTGAATAAATTCAAATAAAAAGATGTAGTTTCAGAGGAGATTTAT
ATAAAATTAAGGTCTAAATTCGATTTGCTGATAAACTCAAAACAGTTATTTTAAAATTTA
GGTTTAGTTGACTTTTGTATAGTCGGCTCTCACGAATTTAGACTATTGAGAAAAAACAAA
TTAAGCATTGATGTTATTTTGAATTATAACAAGGAATAATTAATTAATATTAATACAGGG
GAAGATATATTTTATGAAGCTCAAAAAATATTAAAACAAATTCTTAACAATCATACAATT
AAATTAGAAGAAAAAAACTAGAAAAAATATATCAGAGTTATTGATGATTTAGAGAAAGAA
TTAGAGATGATTATTTATTTTTCTGATGTCTCTGGAGGCTCTTTTTGCAATGAAATCCAT
CATGCAATTTGGTTTTCTTAAGTAAAAACTAAAATATTTGATAATAAAGATATCAGTGCT
ATGTTGAAGTGCTTGAGAATGTGGAAAGAAGCAAGCAATATAAATATCAATACTTCAATA
ATAGATTTTATTATGCATACTGTGACACACAAATTCACTCTCATTAATGCCCCCAAAAAT
CTTGTTAGTTTCTTTGAATTTGTAGCAAACGAAGGAATACAAGATATTATTAACTTAAAA
AACAAAAGAAATATAGAGGTAACTGAGATGCACTTTGAAATGATACAAAAAATAAATAAA
GAAGATTTGGATTAATTTGTTCGATAATGCTAAAGCATTTATAACTCATGTGATTATACT
TTCATGAAAAGTATAAGTCTATGA


>TTHERM_00078870(protein)
MNSQQELYNLNSFQNYQNMNQYPQNYPYYSNNQIIHPSQTANMNNSAGMQYINHEQNYPQ
YQQQSFNQQNYYHQEAAQYQNQNMFQVPPQQVNPYMGYQNNPPINQNVNNLNQNNLLQDQ
YKRSETQSNFQNSYNYSQQQQHDIDPSTIGIDQQLQTVKDKEEINLKTLNKKRKQQEIQE
CLIDQNKNDDQSPQKQDKNENNFVQNLMDDIQLYFPQKPLSVFLREYCSKMKRAMDIICD
ENEKGLGFSSYLIIDGKHYPKGIGKSKKDAREEASMNALAKMGEENSSVKNYFAVMVDKE
KKVHQKFKNEKAKSSSSEQKSKSKDISEEEERALELYDPLHNYREDVSQLANQVLRLSVS
YETLGDQNNWEVICSIGKSLKTMGQGLTIKDAKNISAYKMIHLIEQSNEKTIKTLARKAL
VQQKIDQTNLKLKELQELKAQKEKDEQNTQIKEIQKEQENLEKENKQHQQSLLNTYSCLI
DSNYEKPQELQKPKIKSQQSIISSCLNKFKQKDVVSEEIYIKLRSKFDLLINSKQLFQNL
GLVDFCIVGSHEFRLLRKNKLSIDVILNYNKEQLININTGEDIFYEAQKILKQILNNHTI
KLEEKNQKKYIRVIDDLEKELEMIIYFSDVSGGSFCNEIHHAIWFSQVKTKIFDNKDISA
MLKCLRMWKEASNININTSIIDFIMHTVTHKFTLINAPKNLVSFFEFVANEGIQDIINLK
NKRNIEVTEMHFEMIQKINKEDLDQFVRQCQSIYNSCDYTFMKSISL


>TTHERM_00078870(gene)
ATGAATTCTTAGCAAGAGTTGTACAACTTAAACAGCTTTTAAAATTACTAAAACATGAAT
TAGTATCCCTAAAATTACCCATACTATTCAAATAATTAAATTATTCACCCTTCTTAAACA
GCAAATATGAATAATTCTGCAGGAATGCAATACATTAATCATGAATAAAACTATCCTTAA
TACCAGTAGTAGAGTTTTAACTAACAGAATTATTATCATCAAGAAGCAGCTTAATACCAA
AATCAAAATATGTTTTAAGTACCTCCATAACAGGTTAATCCTTACATGGGCTATTAAAAT
AATCCTCCTATAAATCAAAATGTCAATAACTTAAATTAGAACAACTTATTACAAGATTAA
TAGTACATTATTAATTATTTATAAATTATCATTTTTTGTATTTTTAAAAATAGCAAAAGA
AGTGAGACACAATCTAACTTTTAAAACTCTTACAACTATAGTCAGCAACAGCAACATGAT
ATTGACCCATCTACTATAGGCATAGATTAATGTGAAGATTTTTTATTTTAGATTTGTTTT
ATATTCGAAATTTTATATAAATTTAAATAGAACTCTAAACAGTTAAAGACAAAGAAGAAA
TCAATTTAAAAACCCTTAACAAAAAAAGAAAATAGCAAGAAATTCAAGAATGTTTAATAG
ATTAAAATAAAAATGATGATTAGTCTCCATAAAAATAAGATAAAAACGAAAACAATTTTG
TATAAAACTTGATGGACGACATTTAACTTTATTTTCCTTAAAAACCTTTAAGTGTGTTTC
TTAGAGAATACTGCTCTAAAATGAAAAGAGCAATGGATATTATTTGTGATGAGAACGAAA
AGGGGTTAGGGTTTTCTAGCTATTTAATAATTGATGGCAAACACTATCCAAAAGGTATAG
GAAAAAGTAAAAAAGATGCTAGAGAAGAAGCTTCTATGAATGCATTAGCTAAAATGGGCG
AAGAAAACAGCTCAGTAAAAAATTACTTTGCTGTGATGGTAGATAAAGAAAAGAAAGTTC
ATCAAAAATTTAAAAACGAGAAGGCAAAATCTTCAAGTTCTGAGTAAAAAAGCAAATCAA
AAGACATATCTGAAGAGGAGGAGCGAGCTCTGGAGCTTTATGATCCACTCCATAACTACA
GAGAAGATGTTTCATAATTAGCCAATTAGGTCTTAAGGTAATATTTATACTTATTAAAAA
ATAAACAAATTTTTAATAAAAATTTAAATCAAAGATTATCTGTTTCTTATGAGACATTAG
GAGATTAAAATAATTGGGAGGTTATCTGTTCTATTGGAAAATCACTGAAAACGATGGGAT
AAGGGTTGACTATAAAAGATGCTAAAAACATTTCAGCTTACAAAATGATTCATTTAATAG
AGCAATCAAATGAAAAAACGATAAAAACGTTAGCCCGAAAAGCTCTAGTTTAATAGAAAA
TAGATTAGACCAACTTAAAGCTTAAAGGTAAAATTAATTAATTTCTTTGTTTTTGAAAAA
AAAATTTATTTTTTGGAATTTCTAAATCAGAATTATAGGAGTTGAAAGCTCAAAAAGAAA
AAGATGAATAAAATACTCAGATAAAAGAAATCTAAAAAGAGCAAGAAAATCTTGAAAAAG
AAAACAAATAACATTAATAATCTCTCTTAAATACTTATTCCTGCTTAATAGACTCTAATT
ATGAAAAACCTTAAGAACTATAAAAACCAAAAATTAAGTCTCAGTAAAGCATTATAAGTA
GCTGTTTGAATAAATTCAAATAAAAAGATGTAGTTTCAGAGGAGATTTATATAAAATTAA
GGTCTAAATTCGATTTGCTGATAAACTCAAAACAGTTATTTTAAAATTTAGGTTTAGTTG
ACTTTTGTATAGTCGGCTCTCACGAATTTAGACTATTGAGAAAAAACAAATTAAGCATTG
ATGTTATTTTGAATTATAACAAGGAATAATTAATTAATATTAATACAGGGGAAGATATAT
TTTATGAAGCTCAAAAAATATTAAAACAAATTCTTAACAATCATACAATTAAATTAGAAG
AAAAAAACTAGAAAAAATATATCAGAGTTATTGATGATTTGTAAAATATTTATTTGTACC
TATTTTTATTAAACTTTTAATAAATATAAAAAGAGAGAAAGAATTAGAGATGATTATTTA
TTTTTCTGATGTCTCTGGAGGCTCTTTTTGCAATGAAATCCATCATGCAATTTGGTTTTC
TTAAGTAAAAACTAAAATATTTGATAATAAAGATATCAGTGCTATGTTGAAGTGCTTGAG
AATGTGGAAAGAAGCAAGCAATATAAATATCAATACTTCAATAATAGATTTTATTATGCA
TACTGTGACACACAAATTCACTCTCATTAATGCCCCCAAAAATCTTGTTAGTTTCTTTGA
ATTTGTAGCAAACGAAGGAATACAAGATATTATTAACTTAAAAAACAAAAGAAATATAGA
GGTAACTGAGATGCACTTTGAAATGATACAAAAAATAAATAAAGAAGATTTGGATTAATT
TGTTCGATAATGCTAAAGCATTTATAACTCATGTGATTATACTTTCATGAAAAGTATAAG
TCTATGA