Identifiers and Description

Gene Model Identifier

TTHERM_00016410

Standard Name

DPL3 (E2F Dimerisation Partner Like)

Aliases

PreTt11947 | 1.m00995

Description

Transcription factor E2F/dimerisation partner (TDP)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06131 ) Schizosaccharomyces pombe repeat of unknown

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00016410

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02613.19.997093137033517e-262hypothetical protein (906 aa)
WormBaseWBGene000010610.00000000000001000191320216021locus:dpl-1 Transcription fa
ctor dpl-1 status:Confirmed
UniProt:Q22703 protein_id:
CAA92699.1
OxytrichaContig13224.0.1.g90.0000000000499999055251093E2F/DP family winged-helix DNA
-binding domain
Stentor CoeruleusSteCoe_276810.00000001522997974471263
DictyBaseDDB_G02767990.00000019998969434520019tfdp2 on chromosome: 2 positio
n 7346120 to 7348205

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27892792: Zhang J, Tian M, Yan GX, Shodhan A, Miao W (2017) E2fl1 is a meiosis-specific transcription factor in the protist Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 16(1):123-135

Sequences

>TTHERM_00016410(coding)
ATGACACAGGGAACACACAAAAAATTAATGTTTAAAACTGAAAATCCCCACATAAAAGAG
GACAATCTTTTCAACTCCGTCAACCAATTCAGCCATATGCTGGAATGCAAGATGCCTTAA
GGTTAGCAAAGCGGAGATGAGCAATCTCCTTCACCAAAGAATAATAGCAGCAACCATATT
AGCCCATTTGCCAGTTCAAGATTGTTTAACAATAGCACTCGTTAATTCAATTCGACATTA
TTAAATACTTCAGATTAAAATTAGAATTTTTTTAGTAACAATATTGCTCTTTCAAATGGC
ATAAGCAGTGCAAGCAATTCGAATGGATTTTAAATTAACGGGAATAAGAAGCTTTTCCTT
TCTAGCAGCAAAGCGATTATTTCAGCCAAGGCAATATTGGAAACTTCCGACGATCCTGAA
TCTTCAAATCATAAAAATAATTCAAAAACTACAGCAACTCAATCGCGCAATTCAACCAGT
CACTTCGAAGATCACATGCTTGATTCATTGAAGGATACTACTTCCTACTCGTTGAATTTA
ACAACAAGCAAGGGAATAAGCGGATTCTAAAATAACTTCTCGAACATTAGAAACAGCATT
CAAAATTACCCACTTAAAACCATTAAAAATATTCCATGCGAAAACAGTCTAAATAATTTT
TCATCATCATTATTTTTTGACAATTCGAACGTGAATAACAATAACAACAATAAAAATAGC
AGCAATAACAATAACAACACTAGCGATTTCAAAGCAAATGAAAATTATGAAGGAGGAAAA
ATGATTTAAAATATTTAGATAAATGCTGATTTTTCCTCTCCAACTTATAATCAAAATTCG
TTTAACTAATTTAATTCTTTGAAAAATAAAAGTGTAAAAAATAACACAAATATTTTAGTT
GGAAATTCAAATAATACTCAAAAATGGAATTACCAGAGCACCTCTAAATTAATTCTAAAC
TCAAACCTTTACCAACAATAATTGCATTCTATCAACAACCAGGAAGATGATGAAGGCGAA
GTTTTCAACAACGAGTCCTTGTCTTAGCTTTGGACAAACCCTTCAGTCCTTCAAGCCCTA
ACTCAAAAAAATTTGCAAGCAAGTGAGTAGAACTTATTAACAAATGGAACTTTAAAGCAG
CAGCTAAATAAAAATTTACTTGGAGAAAGCAGTTTCCACAAAAGAAGCAACAGCAAAGCG
AACGAGTAAGCTTTGACACCATCAACAATGAGTCATCTCAACAGCAATGTCAACTTGAAT
AATTCTACTAACTACTTAGATGATGATGATAAAGGCGAGCGTTCCTCAAGAGGTCTCCGT
AATTTGTCTCTTAAAGTAAAACAAATAGTAGTCTAAAAGGGATAAACATCTTACAAAGAA
GTGGCAGATTAGCTTGTTGACGAGCTCAAAAGTCAATCTCTGGGCTCAATGAAACCTGAA
GACATATAAAAAGACGAACAAAATATCAAAAGAAGAGTTTATGATGCATTAAATGTATTA
ATTGCCTCTAAGGTTATTGAAAAAACTGGAAAAGTTGTCAAATCTTGTGATAAATCACAC
TTAAATGGAAGATGCTTGTAAGCTGATAACTGGAAAAATGTTAAGCTTGTTGAGTCTGAA
AGGGATAAAAAAAAAGAAACTTTACTTTAGAAGCAAAAAATCTTAACTGAGTATGCTGCT
AAATACTTAGCTCTCATGAATTTGATGGAAAGAAACAAAAAAACAGAATAGGAAAAGCTA
AATGTTTAATTGTCACAACAAAGTGTTGATTTCTTGAATAATCAAGATTAAGTCTAAGAA
TTAAGTCAAAGAATGAACACAATTAAGGATTAAATAAGTCTAAAAGATAAAATCCTCACA
GATCTTCAACCTTCCAATGGACAAAGCCATATTTTTAAGTTTCCCCTTATCCTTATTTCT
GTACCAACTCCTGAAAACGAGTCTTCCAAGGTCATTGTAAAGATGAGTAAAGACCAAAAG
AATGGAAAATTTTTCAGTCAGTCTAAAATGATAGTTCATGCTGACTTAGACGTTCTTTTG
CAAATGAAAATGCACTAAGTTGATCAATAGTTTGCTTCCAAATATCTTAATTAAGAATTC
ATTTCAAAATATTTAGTTGGAAACTCTTTCTTTGCACCTTAATCAGATTAATCAAACGAG
AGTTCTAATATTAGCAACTGCAGCAATAGAGAAAAATGTATAGAATAGGCAGATAATTAG
TATCTTAATGAAAATTTAGTTTAGTCTGTAAACAAATAGTAGTTTAATCCTCATGAAAAT
TCTAAGTATTAAATCGATGATTCTTCAATCAAACAAACTAAAAAGGCAAAAGTAAGTGCA
TTCAAAAAACCCCAATTACCTAAGAACAACCAAAAGTAATCTGTTAAAATATCCTGTAAA
AAGACAGAAAAAAGTGATAACTTTGACAACGAAATCGAGTTAGATGACTGA


>TTHERM_00016410(protein)
MTQGTHKKLMFKTENPHIKEDNLFNSVNQFSHMLECKMPQGQQSGDEQSPSPKNNSSNHI
SPFASSRLFNNSTRQFNSTLLNTSDQNQNFFSNNIALSNGISSASNSNGFQINGNKKLFL
SSSKAIISAKAILETSDDPESSNHKNNSKTTATQSRNSTSHFEDHMLDSLKDTTSYSLNL
TTSKGISGFQNNFSNIRNSIQNYPLKTIKNIPCENSLNNFSSSLFFDNSNVNNNNNNKNS
SNNNNNTSDFKANENYEGGKMIQNIQINADFSSPTYNQNSFNQFNSLKNKSVKNNTNILV
GNSNNTQKWNYQSTSKLILNSNLYQQQLHSINNQEDDEGEVFNNESLSQLWTNPSVLQAL
TQKNLQASEQNLLTNGTLKQQLNKNLLGESSFHKRSNSKANEQALTPSTMSHLNSNVNLN
NSTNYLDDDDKGERSSRGLRNLSLKVKQIVVQKGQTSYKEVADQLVDELKSQSLGSMKPE
DIQKDEQNIKRRVYDALNVLIASKVIEKTGKVVKSCDKSHLNGRCLQADNWKNVKLVESE
RDKKKETLLQKQKILTEYAAKYLALMNLMERNKKTEQEKLNVQLSQQSVDFLNNQDQVQE
LSQRMNTIKDQISLKDKILTDLQPSNGQSHIFKFPLILISVPTPENESSKVIVKMSKDQK
NGKFFSQSKMIVHADLDVLLQMKMHQVDQQFASKYLNQEFISKYLVGNSFFAPQSDQSNE
SSNISNCSNREKCIEQADNQYLNENLVQSVNKQQFNPHENSKYQIDDSSIKQTKKAKVSA
FKKPQLPKNNQKQSVKISCKKTEKSDNFDNEIELDD


>TTHERM_00016410(gene)
ATGACACAGGGAACACACAAAAAATTAATGTTTAAAAGTAAGTTTTTTCCATTTATTTTA
AAAGAATATTTTTTTAGGATCAAAGTTAATAAATCAATAAATAAATTAATTAATTAATAA
TTATCCTCTTCAAATTGGTTAATTTATTTTGATGAAATTTTATTCATCAATCAGAAAATC
AATCTATCTAATTCAATAAATCAAATCAAAACCAATCTCTTCAAAAGTATCCATTTTTGT
TTCCCCTTTATCTTTAGATAAGAGTTATTATTCAAAAATGAATTCCAAAGCCAACTTAAA
AAGTTTTCAACTATCAAGAGTACAAACACGCTTTTAAGTTATCAATTAGTCTTTAGTTGA
TAAAAACACACCAAAAAAGTATAATTAGAATCAACATTTAATTTTTTTGTAGCGTTTTGT
TAGAAATTTTATCAAAAAAAATTGTTTCAATAATTATTTTATGAAAAAAAATGAAAAAGT
TTGAAATTAAAAATAGTTAAAAAATAATATCTTAAATGTAATTTTCTGGTGAATTTTTAA
ATTAAAATTTAAAAAATAATATTTAACTAGATCTTTAAATTGATTAAAAATAGGTTCAAT
TAAAATTTTTGAACTAATTAATTATTTTCAAAACATAATTTGTTAAAAAATTAATAATGA
GTGAAATTAAAACTTAATAAAAATTTTCATTTTTAATAAACTAAATATTTAAAATAATTA
ATTATCACAATGACAAAATTCTATTCCCGAATCACATTATGGTTCTCAATATAGATAAAA
ACATACATAAATAGAGAGATAGATAGATAGATATAAATATAAATTTTTAATTTAAGAAAA
GGATAATTTTATAACTTAATTTAATAGCATATTTTTAATTTTATTCTAAATATCAAATTA
GCTGAAAATCCCCACATAAAAGAGGACAATCTTTTCAACTCCGTCAACCAATTGTAAAAT
CCTTCATTCTCCGTTTATTTCAATATGAATAACAACCGCAACACGATAAATAAATCAATA
AATCATCTTCCATCATCAATGAAAAAACGATGAAAAGCAAATTGTTCTTTTATAGGATAA
ATCTCAACAAATCAAAATAAACAAACAAAATGTTCAAAAGTAAAAGTGACTGGCCGATCC
AAGCAAATAAAATGATTCAATTATTATCTAGAAACCAATAAATAATATTAAGTAATGAGA
GATTATACTCTTTAACTATTTAAACAATCTATTTATAGTATTTTCTAAGAGTAAATGACT
CAATAACTCACTAATACAATTACCCGCAACTCAAAAACGGTGTTTTTTTTGAAATACTAA
AAAAATCTTGGTGATATTTATTCTACTTATATAGTAGAGATAATTTCAAAAATTACTATA
ACTGTTTTGTTAATCACATTGTTGAGAAAAAAGCAGTGCTAAATTTAGATTTGATTTTAT
GTTAGAAAATAGATTGTATTCCAAAAATGTTTAATTACAAACGATGCTGCTATAAATTAA
CAAACAAACAGTGGTGAATATTGTTTGAGTGAGTAATATGTTTGTGAATGAATTGAGTGA
GTGAGATCAGCCGCCCACTCCCAAATTTAAATTTGATAAAATAAAACTAAATTTATTTAT
TTATTTATATTTGGAAGTAGACTGAATACTTTACTTTACTTATCTCATTTTTGCAAATTA
GCAAATACTAAAAAAAATATATAAGCAAATTGTAAGCGCGTATATCTTTTATGCAAAATT
TGAGTTATTTGACGATTGAACAAATATGAAAAGTAAGATAAAACAATAAATTGGTTGGAT
AATAATTGGTTTATTTGCAGCTTGATTGTTTGTTTATTTGAAATTGGTTGAATCATCAAA
TGAGATAGAGAATAGAGTAATTATTTTTAAGATGTAAAGAATTCTAAGAAAAGGGGAAGG
AAGGAAGGAAGGAAGGAAAGAAAGAAAGAAGCATAAGCATTAATTTCTTAATCCTTTTCA
ATTTTTTTAACTTTCTTCTTGTTTTGATTGATTGATTGATGGATTGATTGATTAATTTAT
TTATTTATTTATTGAATGATTCTTTGATTTGTGATTGCAATATTTAGATTATTCATTTGT
TCATGCATATTTATTTGTGTTTAAATTTTGTAAAAAAATAAAAGTTTTAACGAAAATTTA
TTTTTAAAAAGCAGCCATATGCTGGAATGCAAGATGCCTTAAGGTTAGCAAAGCGGAGAT
GAGCAATCTCCTTCACCAAAGAATAATAGCAGCAACCATATTAGCCCATTTGCCAGTTCA
AGATTGTTTAACAATAGCACTCGTTAATTCAATTCGACATTATTAAATACTTCAGATTAA
AATTAGAATTTTTTTAGTAACAATATTGCTCTTTCAAATGGCATAAGCAGTGCAAGCAAT
TCGAATGGATTTTAAATTAACGGGAATAAGAAGCTTTTCCTTTCTAGCAGCAAAGCGATT
ATTTCAGCCAAGGCAATATTGGAAACTTCCGACGATCCTGAATCTTCAAATCATAAAAAT
AATTCAAAAACTACAGCAACTCAATCGCGCAATTCAACCAGTCACTTCGAAGATCACATG
CTTGATTCATTGAAGGATACTACTTCCTACTCGTTGAATTTAACAACAAGCAAGGGAATA
AGCGGATTCTAAAATAACTTCTCGAACATTAGAAACAGCATTCAAAATTACCCACTTAAA
ACCATTAAAAATATTCCATGCGAAAACAGTCTAAATAATTTTTCATCATCATTATTTTTT
GACAATTCGAACGTGAATAACAATAACAACAATAAAAATAGCAGCAATAACAATAACAAC
ACTAGCGATTTCAAAGCAAATGAAAATTATGAAGGAGGAAAAATGATTTAAAATATTTAG
ATAAATGCTGATTTTTCCTCTCCAACTTATAATCAAAATTCGTTTAACTAATTTAATTCT
TTGAAAAATAAAAGTGTAAAAAATAACACAAATATTTTAGTTGGAAATTCAAATAATACT
CAAAAATGGAATTACCAGAGCACCTCTAAATTAATTCTAAACTCAAACCTTTACCAACAA
TAATTGCATTCTATCAACAACCAGGAAGATGATGAAGGCGAAGTTTTCAACAACGAGTCC
TTGTCTTAGCTTTGGACAAACCCTTCAGTCCTTCAAGCCCTAACTCAAAAAAATTTGCAA
GCAAGTGAGTAGAACTTATTAACAAATGGAACTTTAAAGCAGCAGCTAAATAAAAATTTA
CTTGGAGAAAGCAGTTTCCACAAAAGAAGCAACAGCAAAGCGAACGAGTAAGCTTTGACA
CCATCAACAATGAGTCATCTCAACAGCAATGTCAACTTGAATAATTCTACTAACTACTTA
GATGGTAACAACTATATTTTATTTTAGAATTTTAATTTATTTCTAATCTTTTGATTTTGC
CAGGCGGTGGCGCGATATTTTTCTGTTCAAGTCTGAAAAATAAAATTTCTTTGATAATAT
TTCGATTTAAATTTGGCGGATATCAATCAATCCATAAGCAAATAAATAAATAAATAAATA
AATAAAAATCAAATTAACAAACAAACAAATTATATTTTTTAATAATTTTAATTTATTTAT
TTATTGATTGATTGATTGATTGATTGATTTATTCTATCTCACCAAAGTTAATAAATAAAT
AAGTAATTTAAATTATTAAAAATACTATTTTGATGATATCTTAATTTTTCATTATTGCTT
ACTAATCACCTTAAATTTATTTATCAATTTATTACTCCTCTATTTATTTAAACAGAAAAT
TTCAACATTACTTTGTTTAAATAAAGATTTTTTAGAGTGCTATTAATCAATCAATTCTTT
AATTTTATCTTTGTTAATTTTGTTGATTAACACGCACTCTATCAATCAACTCCCCACCTT
ATACAATTTAAATAGGCTTAACATTTTTTATTTTCCTAGCCACAAATATCTACTTACACT
CCATCATTCTCTAGATTTAAACAAATAATTTTTCTCAAATCTTCAAAATATCTTTCTTTT
TCAATTTTTCACACCTTTTTAAAAACTCGATATCACTCCAACCAACCAAATATTTCTTTT
CATATCTTTTAAGTTTTTTCAAAAGATTCATTAGACTGTCAATTCACTTAACTTTACAGT
AATGACATATGATGATCGATTCAAATAAGCCAAATTAAATATTTATTTTTAACTAAATAT
TCTGCTTATTATTTTTATTTTAAATTTTACCATTTATTTTAAATAAAGATGATGATAAAG
GCGAGCGTTCCTCAAGAGGTCTCCGTAATTTGTCTCTTAAAGTAAAACAAATAGTAGTCT
AAAAGGGATAAACATCTTACAAAGAAGTGGCAGATTAGCTTGTTGACGAGCTCAAAAGTC
AATCTCTGGGCTCAATGAAACCTGAAGACATAGTATTATATAGAATTTAAAGAAACTCTT
ATTTAATCAATTAATTAAAAATTTAAAAATAGTAAAAAGACGAACAAAATATCAAAAGAA
GAGTTTATGATGCATTAAATGTATTAATTGCCTCTAAGGTTATTGAAAAAACTGGAAAAG
TTGTCAAATCTTGTGATAAATCACACTTAAATGGTAATCAATCTATTTTATTAAAATTAT
TTAAGATTTTGTTTGTTTATTTGATTGTATTTTCGCTTTCTAGAACTAATTTTGTTTGAA
TAATAAAAGGAAGATGCTTGTAAGCTGATAACTGGAAAAATGTTAAGCTTGTTGAGTCTG
AAAGGGATAAAAAAAAGTAAAAAATCATTTAAAATAAATTATATGAAAATTAAAAAATAA
ATTTATTTACCTAAAAATTAGAGAAACTTTACTTTAGAAGCAAAAAATCTTAACTGAGTA
TGCTGCTAAATACTTAGCTCTCATGAATTTGATGGAAAGAAACAAAAAAACAGAATAGGA
AAAGCTAAATGTTTAATTGTCACAACAAAGTGTTGATTTCTTGAATAATCAAGATTAAGT
CTAAGAATTAAGTCAAAGAATGAACACAATTAAGGATTAAATAAGTCTAAAAGATAAAAT
CCTCACAGATCTTCAACCTTCCAATGGACAAAGCCATATTTTTAAGTTTCCCCTTATCCT
TATTTCTGTACCAACTCCTGAAAACGAGTCTTCCAAGGTATTTTATTTATTTATTTATTA
TTTTACAAAGTGCACAATTTAATTTTTTCAAATAATTATATAGAATTTTTATAATAAATC
AATTAATTAATTAATTATTATAATTTGAATTTTATAATTGTTTATTTATTTATTGTCTAG
GTCATTGTAAAGATGAGTAAAGACCAAAAGAATGGAAAATTTTTCAGTCAGTCTAAAATG
ATAGTTCATGCTGACTTAGACGTTCTTTTGCAAATGAAAATGCACTAAGTTGATCAATAG
TTTGCTTCCAAATATCTTAATTAAGAATTCATTTCAAAATATTTAGTTGGAAACTCTTTC
TTTGCACCTTAATCAGATTAATCAAACGAGAGTTCTAATATTAGCAACTGCAGCAATAGA
GAAAAATGTATAGAATAGGCAGATAATTAGTATCTTAATGAAAATTTAGTTTAGTCTGTA
AACAAATAGTAGTTTAATCCTCATGAAAATTCTAAGTATTAAATCGATGATTCTTCAATC
AAACAAACTAAAAAGGCAAAAGTAAGTGCATTCAAAAAACCCCAATTACCTAAGAACAAC
CAAAAGTAATCTGTTAAAATATCCTGTAAAAAGACAGAAAAAAGTGATAACTTTGACAAC
GAAATCGAGTTAGATGACTGA