Identifiers and Description

Gene Model Identifier

TTHERM_00047010

Standard Name

DPL2 (E2F Dimerisation Partner Like)

Aliases

PreTt11180 | 3.m01639 | 3824.m02940

Description

Transcription factor E2F/dimerisation partner (TDP)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00047010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01755.19.997093137033517e-262transcription factor Dp-2 (792
aa)
WormBaseWBGene000010610.0000000000005000841553255702locus:dpl-1 Transcription fa
ctor dpl-1 status:Confirmed
UniProt:Q22703 protein_id:
CAA92699.1
OxytrichaContig13224.0.1.g90.0000000020002373268528243E2F/DP family winged-helix DNA
-binding domain
DictyBaseDDB_G02767990.0000029996948234116693tfdp2 on chromosome: 2 positio
n 7346120 to 7348205

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29417875: Zhang J, Yan G, Tian M, Ma Y, Xiong J, Miao W (2018) A DP-like transcription factor protein interacts with E2fl1 to regulate meiosis in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 17(5):634-642
  2. Ref:27892792: Zhang J, Tian M, Yan GX, Shodhan A, Miao W (2017) E2fl1 is a meiosis-specific transcription factor in the protist Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 16(1):123-135

Sequences

>TTHERM_00047010(protein)
MSKLPSDNDVLFQNRSEEVFPRKQKKTNKAGYPNRGSNNNYINGNQNIKNSAILEEEDEY
KNSVKFNGVKSENPDKSQNIRQQILSKKQSSQLFEKNQIEDENARGFDCVFNQNTSKPIS
SKHKDYENSMSSKGDSKFTVKSEQSSMLFASNPNQINSPSIHDTSNINSKILQQSSHHHQ
ISNNNHSEFQNISSKVTNLNSQKDKSQANRTQIGSQQQLSKNQNSITHQLNQNSHNFPYY
QPNNPILYQQSQGFFDADSINQLIKQDQSNKNNNNNNNNNNNNIQINGSQIQSQEQIQQL
QLQSIQNKQSQQMLFNSNSQNQNSNFNHDFINSQFGQNSLLYDLNNSQLFKDSIYSNGLT
RNLLPQNDSDVFDNDGGIVDYFCNDKQENDNKGTLLGKNLISSFAQQTQQNHKNLISSPR
GQANSFQFPNQGFKKSQVKQESLLSSNQNDQNNLIDQARSQVDDYSNNGEQTEERQTLRG
LRALSLKVKEIVQEKGSTTYKEVAETLVQNLKSGQKQLAEKEDIKDEQNIKRRVYDALNV
LIASEVIAKKGKKVLAIAKTNLAGKCLKHDNWKEAKEKQDILDKQKQKVNQKKDQVKELA
RKYVALKNLISRNQSSEKNTQMNSQLFENFINQKDEYDDNQKFFINSQLSNKSQTQGLRD
KILQPLLDVQKQKFQFPVLSVRFNPDDQQRVIMKMSKDKNNLKIYAKGYLETYGDLDILC
QLSLDKVQDQFRQQVLGDKYLNWINSVDHIKTEHIVEEDNENQYPGPYMMNDQNNY


>TTHERM_00047010(coding)
ATGAGCAAGCTACCTAGTGATAACGATGTCCTCTTTTAAAATAGGAGCGAAGAAGTGTTC
CCAAGAAAGCAGAAAAAAACTAATAAAGCAGGATATCCTAATCGAGGCAGCAATAACAAT
TATATAAATGGAAATTAGAATATAAAAAATTCAGCAATTTTAGAAGAGGAAGATGAGTAT
AAGAATAGTGTTAAATTTAATGGAGTTAAATCAGAAAATCCAGACAAATCTTAAAATATT
AGGCAATAGATTCTCTCAAAAAAATAGTCATCTCAGCTTTTTGAAAAAAATTAAATCGAA
GATGAAAACGCTCGAGGATTTGACTGTGTGTTCAATTAAAATACATCTAAGCCAATATCA
TCGAAGCACAAAGATTATGAGAATTCAATGTCCTCAAAAGGAGACTCCAAGTTTACTGTA
AAATCTGAATAATCCAGTATGCTCTTTGCTTCTAACCCTAACTAAATTAATAGCCCAAGT
ATCCACGATACCTCTAATATAAATAGTAAAATACTGCAGTAGTCAAGTCATCATCACTAA
ATTTCTAATAACAATCATAGTGAATTTCAAAATATATCCTCTAAAGTGACAAATTTAAAC
TCTTAAAAAGATAAATCTCAGGCAAATAGAACACAAATAGGCTCACAGCAATAACTGTCA
AAAAACTAAAATTCTATTACTCACTAATTAAATTAAAACTCTCACAATTTTCCATATTAT
CAGCCAAACAATCCAATTCTTTATCAACAAAGTCAAGGATTTTTTGATGCTGATTCAATT
AATTAATTAATAAAATAAGACTAATCTAATAAAAATAATAATAATAATAACAACAATAAC
AATAATAACATTCAAATAAATGGATCTTAAATATAATCTTAAGAATAAATATAATAACTT
TAATTACAAAGTATTTAAAACAAGTAGAGCTAACAAATGCTTTTCAATTCTAATTCATAA
AATCAAAACAGTAATTTTAATCATGATTTTATAAATAGTTAATTTGGATAAAACAGTTTA
TTATACGACTTAAACAATTCCCAACTTTTCAAAGATAGTATTTACTCGAATGGACTCACA
AGGAATTTGCTTCCTTAAAATGACTCAGATGTATTTGATAATGATGGAGGTATTGTAGAT
TATTTTTGTAATGACAAATAAGAAAACGATAACAAAGGAACATTACTAGGAAAAAACTTA
ATTTCAAGTTTTGCTCAATAAACCCAGCAAAATCACAAAAATCTCATATCTTCTCCAAGA
GGCTAAGCTAACAGCTTTTAGTTTCCCAACTAAGGCTTCAAAAAATCTTAAGTCAAGTAA
GAATCACTACTTTCATCTAACTAAAATGATTAAAATAATTTGATAGATTAAGCAAGATCT
TAAGTTGACGATTATAGTAACAATGGCGAATAAACTGAAGAAAGATAAACTTTAAGAGGA
TTAAGAGCCTTATCTTTAAAAGTAAAGGAAATAGTTTAGGAAAAAGGATCTACTACATAC
AAAGAGGTAGCAGAAACACTTGTACAAAATCTAAAATCAGGTCAAAAATAATTAGCTGAG
AAAGAAGATATTAAAGACGAATAAAATATTAAAAGAAGAGTTTATGATGCATTAAACGTC
TTAATTGCTTCTGAGGTAATTGCTAAAAAAGGCAAAAAGGTGCTAGCTATCGCAAAAACA
AATTTAGCTGGTAAATGCCTAAAGCATGATAATTGGAAAGAAGCAAAAGAAAAGCAAGAT
ATTTTAGATAAGTAAAAGTAAAAAGTCAACTAGAAAAAAGATCAAGTTAAAGAGTTAGCA
AGAAAATATGTTGCTCTTAAAAATCTTATAAGCAGAAATTAGTCTAGTGAAAAAAATACT
TAGATGAATTCTTAGTTATTTGAAAACTTCATCAACCAAAAGGATGAATATGACGATAAC
TAAAAATTCTTTATTAATTCTTAACTTTCAAATAAATCACAAACTCAAGGATTGAGAGAT
AAGATACTTTAACCTTTACTAGATGTCTAAAAACAAAAATTCTAATTCCCCGTTTTATCA
GTGAGATTTAATCCTGATGATTAATAGAGAGTGATCATGAAAATGAGCAAAGATAAAAAT
AATCTTAAGATATATGCAAAGGGATATCTTGAAACTTATGGAGACTTAGATATATTATGT
CAATTAAGTTTAGACAAAGTTTAGGATTAGTTTAGACAACAAGTGCTAGGAGATAAATAT
CTTAATTGGATAAACTCAGTTGACCATATAAAAACAGAACATATTGTAGAAGAAGATAAT
GAAAATCAATACCCAGGACCTTACATGATGAATGATTAGAATAATTATTGA


>TTHERM_00047010(gene)
ATGAGCAAGCTACCTAGTGATAACGATGTCCTCTTTTAAAATAGGAGCGAAGAAGGTACC
ATGAATACATCTTTATTAAAAAATAGCTATTGATAGAAACAAATTTTAGCATAAAAGCAA
TTGTAAAATAAAATACAAAATGCAAATTTAGAATATTAATGAGTTTATTGCATCATTTTT
AAATAGCATCCAGCATAGCTAAATCAACAAAATTACAGCAAATTGAGTACTCGGTATTTT
TTCATTCTTATTTCTTTTTATAAAAAATATAGTGTTCCCAAGAAAGCAGAAAAAAACTAA
TAAAGCAGGATATCCTAATCGAGGCAGCAATAACAATTATATAAATGGAAATTAGAATAT
AAAAAATTCAGCAATTTTAGAAGAGGAAGATGAGTATAAGAATAGTGTTAAATTTAATGG
AGTTAAATCAGAAAATCCAGACAAATCTTAAAATATTAGGCAATAGATTCTCTCAAAAAA
ATAGTCATCTCAGCTTTTTGAAAAAAATTAAATCGAAGATGAAAACGCTCGAGGATTTGA
CTGTGTGTTCAATTAAAATACATCTAAGCCAATATCATCGAAGCACAAAGATTATGAGAA
TTCAATGTCCTCAAAAGGAGACTCCAAGTTTACTGTAAAATCTGAATAATCCAGTATGCT
CTTTGCTTCTAACCCTAACTAAATTAATAGCCCAAGTATCCACGATACCTCTAATATAAA
TAGTAAAATACTGCAGTAGTCAAGTCATCATCACTAAATTTCTAATAACAATCATAGTGA
ATTTCAAAATATATCCTCTAAAGTGACAAATTTAAACTCTTAAAAAGATAAATCTCAGGC
AAATAGAACACAAATAGGCTCACAGCAATAACTGTCAAAAAACTAAAATTCTATTACTCA
CTAATTAAATTAAAACTCTCACAATTTTCCATATTATCAGCCAAACAATCCAATTCTTTA
TCAACAAAGTCAAGGATTTTTTGATGCTGATTCAATTAATTAATTAATAAAATAAGACTA
ATCTAATAAAAATAATAATAATAATAACAACAATAACAATAATAACATTCAAATAAATGG
ATCTTAAATATAATCTTAAGAATAAATATAATAACTTTAATTACAAAGTATTTAAAACAA
GTAGAGCTAACAAATGCTTTTCAATTCTAATTCATAAAATCAAAACAGTAATTTTAATCA
TGATTTTATAAATAGTTAATTTGGATAAAACAGTTTATTATACGACTTAAACAATTCCCA
ACTTTTCAAAGATAGTATTTACTCGAATGGACTCACAAGGAATTTGCTTCCTTAAAATGA
CTCAGATGTATTTGATAATGATGGAGGTATTGTAGATTATTTTTGTAATGACAAATAAGA
AAACGATAACAAAGGAACATTACTAGGAAAAAACTTAATTTCAAGTTTTGCTCAATAAAC
CCAGCAAAATCACAAAAATCTCATATCTTCTCCAAGAGGCTAAGCTAACAGCTTTTAGTT
TCCCAACTAAGGCTTCAAAAAATCTTAAGTCAAGTAAGAATCACTACTTTCATCTAACTA
AAATGATTAAAATAATTTGATAGATTAAGCAAGATCTTAAGTTGACGATTATAGTAACAG
TAACCAACTAACTAACTTTATTTCTTCTACAATTTAAATTAAATCATTTCATTTTTAAAA
AAGATGGCGAATAAACTGAAGAAAGATAAACTTTAAGAGGATTAAGAGCCTTATCTTTAA
AAGTAAAGGAAATAGTTTAGGAAAAAGGATCTACTACATACAAAGAGGTAGCAGAAACAC
TTGTACAAAATCTAAAATCAGGTCAAAAATAATTAGCTGAGAAAGAAGATATTGTAAATT
TTTCATAAATAAAATTAACTATTTTATAACAAAAAAAGATTTTTTTTCAAAATTTTAATT
AAAAAACGGGAAAAAAAATTTCTTTTATTAATTGAAAAATTAAGCATTTGTTTTTTTACT
AAAATATTCTTATTTATTTATAGAAAGACGAATAAAATATTAAAAGAAGAGTTTATGATG
CATTAAACGTCTTAATTGCTTCTGAGGTAATTGCTAAAAAAGGCAAAAAGGTGCTAGCTA
TCGCAAAAACAAATTTAGCTGGTACTATTTGATTCCTTGTAAAAATTTTACCATAATTTA
TTAAATTTTAAAAATAAGGTAAATGCCTAAAGCATGATAATTGGAAAGAAGCAAAAGAAA
AGCAAGATATTTTAGATAAGTAAAAGTAAAAAGTCAACTAGAAAAAAGATCAAGTTAAAG
AGTTAGCAAGAAAATATGTTGCTCTTAAAAATCTTATAAGCAGAAATTAGTCTAGTGAAA
AAAATACTTAGATGAATTCTTAGTTATTTGAAAACTTCATCAACCAAAAGGATGAATATG
ACGATAACTAAAAATTCTTTATTAATTCTTAACTTTCAAATAAATCACAAACTCAAGGAT
TGAGAGATAAGATACTTTAACCTTTACTAGATGTCTAAAAACAAAAATTCTAATTCCCCG
TTTTATCAGTGAGATTTAATCCTGATGATTAATAGGTATTTTAATTCGTTTTAAAATTAT
AAATTAAAAAATTTTATTTACAAAATAATTTCATTTAGAGAGTGATCATGAAAATGAGCA
AAGATAAAAATAATCTTAAGATATATGCAAAGGGATATCTTGAAACTTATGGAGACTTAG
ATATATTATGTCAATTAAGTTTAGACAAAGTTTAGGATTAGTTTAGACAACAAGTGCTAG
GAGATAAATATCTTAATTGGATAAACTCAGTTGACCATATAAAAACAGAACATATTGTAG
AAGAAGATAATGAAAATCAATACCCAGGACCTTACATGATGAATGATTAGAATAATTATT
GA