Identifiers and Description

Gene Model Identifier

TTHERM_00107000

Standard Name

DPL1 (E2F Dimerisation Partner Like)

Aliases

PreTt23094 | 7.m00543

Description

Transcription factor E2F/dimerisation partner (TDP)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF08249 ) Mastoparan protein
  • ( PF04018 ) Domain of unknown function (DUF368)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00107000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00426.18.999968595758151e-173hypothetical protein (829 aa)
WormBaseWBGene000010610.00000000000009996062864481225locus:dpl-1 Transcription fa
ctor dpl-1 status:Confirmed
UniProt:Q22703 protein_id:
CAA92699.1
OxytrichaContig17782.0.g920.00000000009998509410508463Transcription factor DP

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27892792: Zhang J, Tian M, Yan GX, Shodhan A, Miao W (2017) E2fl1 is a meiosis-specific transcription factor in the protist Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 16(1):123-135

Sequences

>TTHERM_00107000(coding)
ATGAACTATCTCTCTCAAATCATAGAATAGAGCGAGCTTTCTGAGCTACGTAATAGACAC
TAGCATGAGGGCTTGGCAAGTGAACATTCTGCTCCTCAGCAAAATATGAGTAGTAACTTC
TCAAATGACCAAATTTAGATTAATGATTCTTTGTTGACCAAACCCTACGATACACCCACA
ACACCAGCAAACTATCATTTTGGCAGAATTTCGTCTTTGTCTCGTAATATTAACAGCAAC
AGCATCAACCAAATCTTTCCACCTCATGTATTTTCTCCTACCCCTAGGTACTTAAATCCT
TTAAGCCCTGAGCAAAATCATTATTTTTCTGGCCCGATGATAGAAAGTGCCATTAATCAA
AGTGTCTATAATCATAATCCTATTAATTATCCTGACTTGGAAGAATTTCACCATAGAACT
CCTCTCCCCTCTTCTCATTTGTATAATAATAACCTTATACAATCTAACTACTCATATAGA
AATACTCCTATTCCTATCAGCCCTCACATGCCAATAATGCAATCTGGAGGTGGGCGTATT
CTGAGCTCTCATTATCCTGATAATTGCTAATTTACTCCTTTATATATGCAAAATAATATT
AATAGCAATAACAACTTATTCAATTAATCATATTTAACACAAACACCCTAAAACTAAAGC
CCTTTATAAAATTTAGGAGGGATTAGATGTGATATAGATAATGTGGATAACTAAGGTTAA
GAATCTTAAGAGAATGATGATCCTTTTGGTGAAGGTAATAATCTAGCTTTTCATTTTGCA
AATAGAAGAAGAGATGACGACTAAGACGATATCTAACAATATGAAAGTAGATAAAAAAAG
TTAAAAGTTGAGGAAAAAGAATAAAATTAAAGAAATTAAGAAGACGATAATGCTGATTAA
AATTCTTACACTGAAATTAATCCCATGAATGGTATTTACGGGGAATTAGATAAAAAAGAG
GAAAACCTAAATTAGGAATAAAACTTTAATAACAACACAGTTATAACAAGAAAATAAAAT
TTTAATATCTCACCTGAAAATCAAAAATATTAAAACACTCCATTGAAAAATAACTTTGAT
AACCAAAGTTTCATGACTCCAAACAATTAAAATTTTATGACTCCAAATAATTAGTAAAAT
CCAAATACCTAAATAGACACAAATCTCTAAACTCAAACTCAAAAGCAAAAAAATGCACCT
TACAACAACAGCAATCTTTTTTAAAATAATCAATTTGAAATTCCTTCGAACTAACGCTAA
AAAATTAACAGAATTGCAAATCAAAAGCAAACAAATGGTAATTGCACAGCTTAAAATGAT
GGTAATGATTCTGACGATGAAAATAATGGAAATCGTAACGAAAGAGGTCTAAGAATTTTA
AGTAAAGAAGTACTTGAAATAGTCCGTGAAAAAAATGAAACCACTTATAAAGAAGTTACT
GATGAAATTATTCAAAATCGTAAAAAAAATAATTAAAAATAAGTATAAGAAGAATAGAAT
ATTAAAAGAAGAGTCTATGATGCATTGAATGTTTTAATAGCTGCAGAGCTAATAACTAAA
AGTAAAAAATAAAATAAAGTTATACAATACAATAAACCTTTAAATGGAATTTGCTCTAAC
ATCTAAAAAATTCCAGTAAGTAAGAACTCAAAAGAAGGAATTAACAATGTAGTTAGTAAC
AACTAACTTGAAAAGTAATAAAATCAAAAAACATACTTAAAAAACTCCTTGGATTCTAAA
AAAGATCGCTTAAAAAGAAAACATGAAATTCTCAAAGACTTAACTTTAAAGATGCTTGCC
TCAAAGCATCTTATTAAAAGAAATGTTTAGAATGAGCTTATTAAAATGAAAGAAGAACAA
AATGTAAAACTTGGAAATTCTGCTTCTTCTAAAGATTCAACTCAAACTCTCAAATGCATT
TCTTTGTCCAAGGGCGCATCAACTAATGGAGAAGAATAAATAAAACTTAAATTTCCATTT
ATTGCTTGCTAATCCCCTCCAGATAATTCTAAAATGAGTTTCAAAAAATTCACAAGTGGA
CTAGCTATCTGTTCTATGAAACAACTAAAATTAAAAGGTGATATAGATCTCCTGGTTTAA
ATTTATGAAATGGATACAAACACAAATAAAGGAAATGACATTTAAGAATTTTTAGATCCT
GAACTTTATCAATTTTTAAATGAGGTTCAATCCAAACTTTATGATGAGGAAGTTAAATTG
GAATAAGAATTCACTGTTAGCAACAACAAACACATTCAACAAATAGTTTAAAATAGCATT
CATAATCAATAAACTCAAGATATTTAAAAAAGCAGACAATATCAAGCTAAAGATCAATTG
ATTCATAACATTAAAAACGAAGATGAAGAAAATAGCTCTTAGATTACCACTAATTAATTA
AATGATGCAAGAAATGACCTTGAAAACTAACACACTAATTAGACCTACTAAGTAATTTAA
GGTTCTGAGATTCACTAAAACTGTGATGAATACGAAAATTATATCAATTGA


>TTHERM_00107000(protein)
MNYLSQIIEQSELSELRNRHQHEGLASEHSAPQQNMSSNFSNDQIQINDSLLTKPYDTPT
TPANYHFGRISSLSRNINSNSINQIFPPHVFSPTPRYLNPLSPEQNHYFSGPMIESAINQ
SVYNHNPINYPDLEEFHHRTPLPSSHLYNNNLIQSNYSYRNTPIPISPHMPIMQSGGGRI
LSSHYPDNCQFTPLYMQNNINSNNNLFNQSYLTQTPQNQSPLQNLGGIRCDIDNVDNQGQ
ESQENDDPFGEGNNLAFHFANRRRDDDQDDIQQYESRQKKLKVEEKEQNQRNQEDDNADQ
NSYTEINPMNGIYGELDKKEENLNQEQNFNNNTVITRKQNFNISPENQKYQNTPLKNNFD
NQSFMTPNNQNFMTPNNQQNPNTQIDTNLQTQTQKQKNAPYNNSNLFQNNQFEIPSNQRQ
KINRIANQKQTNGNCTAQNDGNDSDDENNGNRNERGLRILSKEVLEIVREKNETTYKEVT
DEIIQNRKKNNQKQVQEEQNIKRRVYDALNVLIAAELITKSKKQNKVIQYNKPLNGICSN
IQKIPVSKNSKEGINNVVSNNQLEKQQNQKTYLKNSLDSKKDRLKRKHEILKDLTLKMLA
SKHLIKRNVQNELIKMKEEQNVKLGNSASSKDSTQTLKCISLSKGASTNGEEQIKLKFPF
IACQSPPDNSKMSFKKFTSGLAICSMKQLKLKGDIDLLVQIYEMDTNTNKGNDIQEFLDP
ELYQFLNEVQSKLYDEEVKLEQEFTVSNNKHIQQIVQNSIHNQQTQDIQKSRQYQAKDQL
IHNIKNEDEENSSQITTNQLNDARNDLENQHTNQTYQVIQGSEIHQNCDEYENYIN


>TTHERM_00107000(gene)
ATGAACTATCTCTCTCAAATCATAGAATAGAGCGAGCTTTCTGAGCTACGTAATAGACAC
TAGCATGAGGGCTTGGCAAGTGAACATTCTGCTCCTCAGCAAAGTATTTCGTTTATCCTT
TCTAATTTACTATTTTAATCTTAGTTTTTGTTCCACTTTCCAAGCAGATTTACTTACTTA
CTTAATAATGCTTAGTTGCTTTATTTTAGCTGCTCTTTGCATTTATTAGAAGCCAAATTA
ACTATTTTATCAAAGATATTCCTATTTTAGTCATCTCAAAATGGCTTTTTGGCTATACAA
TCAGTTTTTTTTGGAGTTTTTGGAACATTTCTTTGCAGCTGCTCTATTTAAATAGATATA
CAAAGCTATATTATTTGCTATTTTTGACTATTTTTTTAAAATATAACACTAGATATGAGT
AGTAACTTCTCAAATGACCAAATTTAGATTAATGATTCTTTGTTGACCAAACCCTACGAT
ACACCCACAACACCAGCAAACTATCATTTTGGCAGGTAAATGCAATACAAAAATTTAGTT
AGAGTCTAAGGACCAATAATAGTTATTTATCACTTAGCTAGCATTCATCTTTTAGCTAAC
CACACGCGTATTCCAGTAGGAATTAATAGAATAGATAGATTGAAGATTGAAATGAAACAA
ATGATAAAAATATTTATAAATTTCAAATAATATAAAGATCATTTTTTATAATTTGCTAAT
TTTCTTATTTAAATATCTAGAATTTCGTCTTTGTCTCGTAATATTAACAGCAACAGCATC
AACCAAATCTTTCCACCTCATGTATTTTCTCCTACCCCTAGGTACTTAAATCCTTTAAGC
CCTGAGCAAAATCATTATTTTTCTGGCCCGATGATAGAAAGTGCCATTAATCAAAGTGTC
TATAATCATAATCCTATTAATTATCCTGACTTGGAAGAATTTCACCATAGAACTCCTCTC
CCCTCTTCTCATTTGTATAATAATAACCTTATACAATCTAACTACTCGTAAATAATTAAT
TACAACACATTTTAATCAAAAAACCATATTTTCAACTATAATTTTATTTGTTTTTCAACA
TTAAGGTTGCAAACATAAAATTAGTCGTATATTATAAAAATAATATATATTTTATTTTTA
ATTTTTGAAGGAAAATTAATTTATTTTTAGCAATATCCATAAAAAACGATCTTTTTTGTA
GCAAAAAATAGTAATCTCTAAATTTTGTAGTGTTGCTGCTTATAGATAAATAGATTAACT
AAATTTAATATTAGTACTCAAAATTATAAAAATCTTTATTTACTTCTTCGGATTGAAATA
ATCACAAACAAAATAGAAATATTGATTCTAAAATTTAAAAAAAAATATTTTTAAAAATAG
CAATCTAATATTAAATAGTTACATACAATTCAGCATAAATAAGAAAATTTTTAAAACTTT
TATTAAATAAATACAAATTTTTAAGTTAAATTGATCTTGTTATATATTTCTTAATAGATT
GGATCTGTTAAATCATGATTATATACATAAAAAATTATTTTTTAAAAATAGAAAAGTTAT
TTAATAATTTTTTCATTAATATAAAGATATAGAAATACTCCTATTCCTATCAGCCCTCAC
ATGCCAATAATGCAATCTGGAGGTGGGCGTATTCTGAGCTCTCATTATCCTGATAATTGC
TAATTTACTCCTTTATATATGCAAAATAATATTAATAGCAATAACAACTTATTCAATTAA
TCATATTTAACACAAACACCCTAAAACTAAAGCCCTTTATAAAATTTAGGAGGGATTAGA
TGTGATATAGATAATGTGGATAACTAAGGTTAAGAATCTTAAGAGAATGATGATCCTTTT
GGTGAAGGTAATAATCTAGCTTTTCATTTTGCAAATAGAAGAAGAGATGACGACTAAGAC
GATATCTAACAATATGAAAGTAGATAAAAAAAGTTAAAAGTTGAGGAAAAAGAATAAAAT
TAAAGAAATTAAGAAGACGATAATGCTGATTAAAATTCTTACACTGAAATTAATCCCATG
AATGGTATTTACGGGGAATTAGATAAAAAAGAGGAAAACCTAAATTAGGAATAAAACTTT
AATAACAACACAGTTATAACAAGAAAATAAAATTTTAATATCTCACCTGAAAATCAAAAA
TATTAAAACACTCCATTGAAAAATAACTTTGATAACCAAAGTTTCATGACTCCAAACAAT
TAAAATTTTATGACTCCAAATAATTAGTAAAATCCAAATACCTAAATAGACACAAATCTC
TAAACTCAAACTCAAAAGCAAAAAAATGCACCTTACAACAACAGCAATCTTTTTTAAAAT
AATCAATTTGAAATTCCTTCGAGTAAAAATTAAAATAAATTATTGTTTGATTTTCTAATC
TGTTTTTAATTTAACCAAAAGACTAACGCTAAAAAATTAACAGAATTGCAAATCAAAAGC
AAACAAATGGTAATTGCACAGCTTAAAATGATGGTAATGATTCTGACGATGAAAATAATG
GAAATCGTAACGAAAGAGGTAAATAAATAAATAAACAAATGAATGAATTACATATGAAAA
TACAACTTATAAAATATATATTTGAAACATAAAATTTTAATTAATGATATTTATATATAT
CTATGGAACTAATTTATGTTAATTTATTAATAGGTCTAAGAATTTTAAGTAAAGAAGTAC
TTGAAATAGTCCGTGAAAAAAATGAAACCACTTATAAAGAAGTTACTGATGAAATTATTC
AAAATCGTAAAAAAAATAATTAAAAATAAGTAAAATAAATATTGAGCTTTAAATTAGAAT
ATATTAAATTATGTAAATTATTGTGTTATTTAGGTATAAGAAGAATAGAATATTAAAAGA
AGAGTCTATGATGCATTGAATGTTTTAATAGCTGCAGAGCTAATAACTAAAAGTAAAAAA
TAAAATAAAGTTATACAATACAATAAACCTTTAAATGGAATTTGCTCTAACATCTAAAAA
ATTCCAGTAAGTAAGAACTCAAAAGAAGGAATTAACAATGTAGTTAGTAACAACTAACTT
GAAAAGTAATAAAATCAAAAAACATACTTAAAAAACTCCTTGGTATGTTATTTATTTATT
TAATTCAAATGTAAATTAACCATTTATTTGATCATTCATAAATTAGGATTCTAAAAAAGA
TCGCTTAAAAAGAAAACATGAAATTCTCAAAGACTTAACTTTAAAGATGCTTGCCTCAAA
GCATCTTATTAAAAGAAATGTTTAGAATGAGCTTATTAAAATGAAAGAAGAACAAAATGT
AAAACTTGGAAATTCTGCTTCTTCTAAAGATTCAACTCAAACTCTCAAATGCATTTCTTT
GTCCAAGGGCGCATCAACTAATGGAGAAGAATAAATAAAACTTAAATTTCCATTTATTGC
TTGCTAATCCCCTCCAGATAATTCTAAAGTAAACTTATTAAAAATAAATAAATCATTTAT
TTTATTTGGCAGGAATAAAAATGTATTTTATAAATAGATGAGTTTCAAAAAATTCACAAG
TGGACTAGCTATCTGTTCTATGAAACAACTAAAATTAAAAGGTGATATAGATCTCCTGGT
TTAAATTTATGAAATGGATACAAACACAAATAAAGGAAATGACATTTAAGAATTTTTAGA
TCCTGAACTTTATCAATTTTTAAATGAGGTTCAATCCAAACTTTATGATGAGGAAGTTAA
ATTGGAATAAGAATTCACTGTTAGCAACAACAAACACATTCAACAAATAGTTTAAAATAG
CATTCATAATCAATAAACTCAAGATATTTAAAAAAGCAGACAATATCAAGCTAAAGATCA
ATTGATTCATAACATTAAAAACGAAGATGAAGAAAATAGCTCTTAGATTACCACTAATTA
ATTAAATGATGCAAGAAATGACCTTGAAAACTAACACACTAATTAGACCTACTAAGTAAT
TTAAGGTTCTGAGATTCACTAAAACTGTGATGAATACGAAAATTATATCAATTGA