Identifiers and Description

Gene Model Identifier

TTHERM_00203010

Standard Name

DPK1 (DNA-dependent Protein Kinase 1)

Aliases

PreTt13773 | 17.m00380

Description

DPK1 phosphatidylinositol 3- and 4-kinase family protein; PIKK family protein; homolog of human DNAPK_cs

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.2%

TetraMine Data

TTHERM_00203010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16706.19.997093137033517e-262phosphatidylinositol 3- and 4-
kinase (4311 aa)
OxytrichaContig21910.0.g389.99838497179609e-146NUC194 domain
DictyBaseDDB_G02811678.998828411824735e-101dnapkcs on chromosome: 3 posit
ion 4132807 to 4145996
Stentor CoeruleusSteCoe_26291.6889118802245324e-48
SGDYKL203C1.0002335610448659e-38TOR2 PIK-related protein kinas
e and rapamycin target; subuni
t of TORC1, a complex that reg
ulates growth in response to n
utrients and TORC2, a complex
that regulates cell-cycle depe
ndent polarization of the acti
n cytoskeleton; involved in me
iosis
WormBaseWBGene000025833.9997566980151843e-38locus:let-363 Target of rapa
mycin homolog status:Partial
ly_confirmed UniProt:Q95Q95
protein_id:CCD61569.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00203010(coding)
ATGTTAGAGCATTTACTTGAAAGCGCTTTAATAAAGCTTTATTAAGGGAATTTTACTGAT
TCTAAGCAAATAGTTTAAGCAATTTCAGATATTTTATTAGATGAAACTTTGGATGATTCA
TAAATATCTCTATGTAACTCTAAGATTTTCAACAGTGACCTCAACTTGTTCACTTATTTG
GAAAACAATAGGACATATAAAGATAATTTGTAGGCTTAGATTAGAAAAGGATTATTTAGA
ACAATAGCAGCATATATTAAGTTAAGAAAGCTCAAAGTATTTGAGTACATTGAGCTAATA
TGTAAAAATTGTATGTCCTTGTTTAAGAAAGAGGAATCAAATTAGGCAAAGGAGACATCG
CTTAGTCCTATTATCAAAATTATTAAATGTATAGATAACTCAGAGCTATTAGAAAAAATA
ATTGATCCTAAAAATACGATATCAGCTTTACTTAATGAAATTAAATTTTGCAAGCCAACT
CAAAAAGTGAAAGGATCAATATGGAACTTGATAGGAATCATTTTTTAATTTTTTACTGAT
CAACTAGAGGACGATCTAAAAGCAGAAATACAAACTGTTTGTTTTAAAGAACTATAAGTT
CAAATGGCAAGTTAAAAGCCTGAAGTATCTTACGTTTCTGGCATGTTTAAATCATTTAGA
TACTCATTAAAAGAAATTCATTTGAGCAACAAGGAATTGGAAGATCTTTATAAGATGATT
AAAATTGGCATAACAGAGATAAAAGATGTGAAAACATATTCAGTTATTAATAATGCTTTG
AAAGTGTTGACAGCTTATTCTCATATTTTTAAGGTTCAGATATTAGATGACTCAAAAGAA
ATTATTGATAAGGTGTTGGGATTAATTAGCCATAATAATAGAGATGTTAAGGAAAATGCA
TCTGACTGTCTGGAATCATTAATGGCACTACTTGCAATTGAACTAGATTCAAGTTATAAG
AACCATGAGCTTTCATTTAACTATATTATCTAGAAGATGAGTTTTCTAATAAATTAAGAG
AGATAACAAATATATACTGCTTCAATAACAGTCATCATAAAATCTATTGGTATTTTCTCT
AAAGCTATAGCAAAGCATTTAGGCTAAGATTAGCTTCAATTATTTTTTAAGCAGATGATC
AATCTTTCTGAGGTTAGATTATTAAAGCACATAGAAAAGGATGGTGTTAATAGTGTTGTT
GATTTTTAACCCGTTGAAGATGAGACTATGAAAAAAGGAACATCATTTAAGACTATTTTA
TATAGATAGAAATAAGTCATCTCTTTTATTACCTCCTTTGCTAATATTATCTCATAATTA
GATAAATTATATGAAGATGAGTCTCAGAGTCTTTTGAGATTATGCATGGTTGGATTTAAG
CAATTTAGTTCATTCTATGAGAAGTATAAGGAACCACTTAATGAGGGAATAGTTTAACTG
ATGAGAGAAATGAAAAAACATTAATCTATATATATCATCTGGCTTGAAAATTTAGTTTAA
AATGGACTTGTGTAGAGCATAAAATTACCTGACAACTCTTTCTTGTCTATGCAAGAATAT
TATGAGACATTAAAAAGTTGTAGCTAGTTTTGGAAGAGTCTTTTTAACTGCTAGTTGTGG
ACTGATGAGACTCTACACCATTTCTCTGCTCAATTCTTTTAATATATCATCTAGCTTCTC
GAAAATACAGATCTAAGTTACAAGGTTGTTTACACTTAGTAAATTGAAGAAGATGAGATA
AAAGATAAAAACCAAATGGAAATAGAATAAGATAAAGAAAGCAAGATCTAAGATATTATA
AGGGAAATTCAATAAGTTTAATATGTTGCAAATAACGAAGTGGATTTGCAATTTTTCTAC
AGAAATTTAGGAAAATATTAAGACGAATTACTCATTGACTGCTTAAAAACTATGCTTAGT
ATTCCATTCGAAGTGCTCTTAATAGATAATTACTCTTTTTTTAGGAAAAATTTAATTGTA
GCTTTGAAAAAAGGCTTTGAATTAGGAGTGTAAAATGTTTCTATGGGATTTGCAGCTATT
GAATGCTTACAGAAAATTATAAAAAGAAGCAAAAATAGGGTTGTTTTTAAATATTTAAAA
CTAGTCATTCCTTATCTTTCTGAATATTTATCAATAACAAAAGGAGAACTTGAAGAAATT
ACTTCTGATATGAAATATAAAGTACAAAGTAATAACTAGTAAAGAGATATCTTTAACTTA
ACAGTTAGTGAACTAGGCTAAAGGAAGAAAGATTTAATTGAAAGGGTAACAAACTTACTG
GGTGATATCGGAGGAGAATCTCATCTAATTGTTCTTAGTGAAAAAGGGTTTTAAGGAAAT
GTTGAGAGATAGCTTTTAAGTGAGTTTGAAAATTTGCAAATTTCAAAGAAGGGTGTTTCT
CTTATTAGTTGGGATTATGAAGCTAAAGTTCTATTCCCTCTTCCACTACTAGCAAAGAAA
ATAGATATAAATTTAACTAAGCTTCTCCCTCGTATGGTAGAACTCACTCTTAATCCTGAT
GACAAAATTAAGGTATACGCATGCGAAGCTATTCATGCAATTACTATTTACATGATTGGA
ACTTAAGCATCATCAATTTAAGGAGGATAAAAGAAGAGAGGAAGAGATATGGAAAATCTA
ATTAAGTCAAAAGAGGAATTCTCAAAAATATATTCTAAATTATTTCCTACAATTTTTTCT
ATTGGAAGTAATTCAAGCCACCCAAGTTGCTAGTTAATGAACTAGTTAATACTCTAAATT
TCACGTTGGTTTGCTAACAGCAAATAACTAGAGTCACCAGAAGTTGCAGAACTATTAGAC
AACATTATGAATTTCATCTCTTCAAAAGATAATAATAACTTGAGAGAACTTGCAGCAAAT
TGCTTGGGTTAATTCATAAAATGGACTCTGAAGCAAAATACAGAATAAGAAATTAAGGTA
AACCACAGCAATATTAAGTCAGCTTTAAGGAGAATTATTTCTTTTTCAGGATAACCTGAC
CTTTCTAAGAGATTTGGTGCTTTGCTTGCTCTAAAAGAAGTTGTTAATAATATTAAAAAT
GAGTCATTTTTAGTTGATAAATTTATAATGGAGACAATACAAACTTCTATGAGAATTGTA
TAAAAGACGGGTGTAAGTAATGAGGTTGAAGATAATTTCAACATCTTGATTAAGTTATAG
ACAAATATTATCTAAAAGAATTATAAAACTTTAAAGGCAAAGAATGAAAACAGAAGTGGA
TAATTTAAACTGTTAGATTCTCTTCTTGACTGGTTATATAGCTATGGATTTTTTAACTCG
TCATATTTAGTTAGGAAAAGTTCTTTTGAACTTTGGCAATCTATTCTTAACAGAGAAGAT
TCTGATATAAGCTGTAAAAAATTTTTAGCTAAAAGAAAATAAGGAGATAACTTGTTTGGA
GATTAAATTAAATAACTAAAATTAGCCATAAACTCATAATCCTACTTCAGAGAGATAAAT
GTTTTACTATCTCAGTTAGATGTAGTAACTTTTATCGTTAAAAATAACTTCTTCAGTGTA
TAAGAAGAGTTACTTTAATTTGAGGATATTATAGATTCCTTTTGCACTAACATAGAAAAT
TTCTTTAACTCTTTATTTAAGATATAAGAGTCGTATTTAAAGTCTGATGGATTATTGATG
GAAATTTTACTTGATGATGCAGTTGATATTGACATTTAAGAAAATTAATACTAAGCAGTT
ATTAATTTGTTTATTAAGATATGTGAATTTATGTCTCTACTATCTAACGACATACTAAAT
TTTACTACCTTTTTGGATGTACTTTTAAATATCACCCTTGAAAATAAATACTCAATATTT
TTATAGATGCTCCTCAAACCTAATCATTTAATAAGAGGTATGAATATTGATATCTTTTTA
ACAAAGAGTGAGCTTTATTTCGAAAAAATAACTCCTGTTATCAAGGCACTATAGGAGATT
ACTCAAGAAGGAGTTGACTTCTTTTAAGATTATGTTTTAAAAGCCTTAGAAGATATTTTT
AAAGGGAATAAACCATAAAAATTTGAAGAAATAATTTCAGATGAATAAAAGCTCAAAGAA
AATGAGCTAAAAATATTCCTTGAGGGTATAAAATTGATTTTCAAGCTATGCTCATAATCT
AGCCGTTATACAATTAGATATATCGAAAAGGCTATCTCAGGAATTTTGAATGGGGTTAAG
TCTTCAGAAGAAAATATTTTAAATAAGCAAGATTCTTTATTTAGAGAAAGCAGGACTCAA
CAAATATTTTAATTCGCCCTTGATATAAGTAGTGAATCTACAAATGAATTTATATTGCAA
ATAATTAGCTAATAAAGTTAATTCTTCCAGAAGTATGAGAATTAGCTGCTTACATATGTT
AAAAGTAAGTGGAATCTTATAGGATAAAAATACTTGATGCTTGCTAAAGATAATATCTCC
TTATTAAAGCTGACGATTCCTCTTTTATAGAGCATTATTTAATCTTTTAATAGAAAAGAA
AAGGAAGAAAGCTTGCTTATTCTCATATAAAATTTACCAGTTATTAATATAGAAAGAAAA
GAAGATACCTTCTTGGAAATTGAATTGAAATTAAACTGGCTAATTATGTCTTCAATTGAA
GGTCTGGTAATTGAAAAAAATTATTCAGATTATGTTGAAAAATTAATTGAGGTTTCTCTT
AAAGTTGAAAAAAGTTTATTCATTCATGAGTAAGGATTCAACTTGCTTGGGTTTTACTTG
AAATGCATAAACAATGCAGACTTCTTTGTAAAAAGGGGTCTTAGAGACAAAGTAAATTCA
GTTCGTTCAAAATATTTCCCTATGAAAGTGAAAGAATTAAAAAGAGATTCAAAGCAAGAA
ATAGACTTTAAATCTATTTTAGGATGTATGATTAACATGATCAAATTAGCAGGATAGATT
GAGTTGCTTGAAATACTTTTCCCTGTTATTCGTGAAAGCTTAGAAGAACCTTATCATACA
AAAATAATAACATTCATTCAATAGTTTATTAAAGAAAATTTCATGACCCAAACCGTTAAT
AAACAACTCTATTTTATGGAATGGGCATTAGATCAATACAAAGATAAAGATTTGGACAGA
AGTTTGTTAGAGTGCATCAGATATGAAATCATTTAAAAGGTATTACTCCACCTTATTGAA
AACGCTAAAGAAGAAGCTAATGTCAAATTTATGGTAAAAAACTCACCCTATCTAGAGAAA
TTATTTTACAATACAGATTTTATGAAATAAGAAAATATGAAAGAAGTTTTGAGATGGGTG
CAGGAACTTATTTAAGTCTTCAACATATTCGAAAGTTTGTATAAGGCTTTAAGCTTAGAT
AAAATAAAGGATGATGTGCATAAGAAATTATATCCAGATACTACATAAGGCAATGAGCTG
ACTAAGAGTTTAATAAAAATAGCATTTGAGTACAGAAAGAAAGGATTTGAGAGAGCAGAT
GATATAAAGAATAATGTTTAAAATAATCCTGATCTTATAGGTATTGATAGTCACTCAATA
CTTAGATTATTCTCTTGTGCTGTTTATAATTGCTTATCTTAAATTATCACAAAAACTTAA
AATAAAGAAAATATCTTGAATTAATTCTTATTTTAATAAAAGAACGATCATCTTTGGGAT
CTTTTAATTGATGGTACTTAAAAAGAATTTAATTTTGAAATAGAAACTAATTTTGAAGAA
AGATCGTATGCTCGTACCAGAAATATTTTTTCAAGGATTCCAAAATTCGATACAAAAGAA
ATTCTTTGCAAAAAATATTTAAATGAGACAGTTCTTTGCACTTTTAACAAAACTTCTGCT
TCATAAGCATTTTTACCCTCTTTTGCAAATGAGTTGATTAGCAAAAACAGTGAACACGAT
ATATATGAAGACGAAGAAGATGAAAGTGAAAATATTATATAAGAAACAAAAAAATATATG
CAGTAACAATAAAATTTATTTTTTGGAGATTAAACTGGAGAAAATTTAGAAATGGACTTA
ATCAATAGACATCCTTGTATGCCTACAGTTCTCACAAATATTGATAAAATGGTTTAATAG
TTCCCTCTTACTGAAGCTATGCCCTAATGGATGACTAATTTATTAGAAGAAGTCAAGAAA
GATAGTTGCAGCTTAGGTCAAAAAATATTTATAATTAAAATTGTTTTGAACAAGCCATTG
TTGTTTGAGAAATACTCATAACAGTGGTTTGATGTGTTAGTTGATTATGCAAAATTAAAT
GATAATGGTTCAAAGTTCTTCCATTACTTTTTAAGAGATGTCACTACAACATTAATAGAT
TGGTGTTCTAAAAAACCTAATTTAGTAACCAGGAGAATAGCTTCAGATAAAAAGTAAAAT
CTATGCTAGGTTATAAACAAAATATGCAGAGTTTTAGCTCACAAAGAAAAAGAAATCTTT
AAATAAAATATTCAAATTTTAAAGAATTTATTGGATTTATGGAAAGAGTGCATTTATGTT
GATGAAAATTAGTTAACAAAGATGTTATTGCTTGAAGATAAAGAAGACAAAGAAAAATCA
TAGTTATGGAACCTAAATTCTATTTTAATTTTAGATGCTTGTATTTAATTAAGAATTCCT
ATACTTTCTAACTATGAAGCATTCTCAAGAGCACAAACTGTAGAAGAGAAATTTGCTTTC
TTCTTAAATATATCTGAAAAAGATAGACTCAAGAGACTATTATTATTTTAATAACACTCT
AAAAGGCAATACTGTAAAGCTGCATCTGCTGTTTGTGGAGGCCTTTTGTCTATGATGCAT
GAGTACGGTGGTTAATTTGAAGGAAAGAGGAAAATTTATGAGCAGGAAATAGTGAATAAT
TCTGTAAATATTATAAACAAGACTGATAAAACTAGCAAAGAAAGATTCCCCATTATCGTT
GCCTGCATCACTTAATACTACCCAGACTTTTTGAATAATATAAAAATTATTACCTATTGC
CAAGACTATATCCATTAAAAAAGTAAAATGGACCGTGCTTACATTCTACAATCAATTCTA
ATTTTCTTGAAAAAGAAATTAGACAAAAGAGAAAATATGAAAGAAGATATCCACAAAATT
TGTACTTCTTTTAGAGGAGTTGTTTAGAATGTTGCAGAAGATGAAAACGTTGAAAACTAA
GAAAAATTTTTAAGTCTTTTTGTATTTTTGAGCAGTCCTCAAATATTGAACTCATTCGAT
GATGCAATACAATTAATGAGAATCAGTATTTCCATTTTAAAACAGAAATATGAAAGGCAC
TATCAAGAAAAATTTGCTACAGCATATTACACAATAGTTTACAATTTATATGATTACCTC
ATCAACCAAGAAAGTGATTTAAAAGATAAAAATCAGATAAATGAGAGTGAAGAAATGAAT
TAATTCAAATCTTAAGTTAAGTCATGTATCCTATGTGGTTTGACTAGTCAACATAATACA
ATCAGAGAAAATACTTTCAAGTTCTTAGACAGGGAAACAAATGACTCAAAAACGCCTTAT
GAAAGGCTTTTATACTTGATTTAGGAAATCTACTAGCCTGAATAAGAAAGGCTATGGTTA
TTGAGTGCTGTCCCACTTATTATGTGTCTATCAAAGAGGACTTCAGACTATGACAAAAAT
CTTTTTGATGAGTAACTTAGTAAGTTAGCATAGTTCTATGATTGGGATTTCAGAGATTCT
CATAACATGAGACTTTACAATTCAAGTCAGCCATTGACTCCTCTTTACACCCTCTCTCAA
GTTAATTATAAAGACTCATAAGGATTTGCAATACCAGCTCCTCGTCGTATGTACAATATC
ACAGGAGTTAGTTAGATGCCTATATAAGAAGGAGTTAGAGCGACTGTTTATAGTTAATCC
TAAGATAACAGTTAAGGTGAAATGGTTATTCCTTCCTAAGATCAAGCAAGCTAAATGAAC
CAACTGGAAGAAAAGAGATAAATTTACCAAGATTAAATGAAAAGACTGGTCAATCCTTCT
CAATAGATTTCTTCATCGTTTTCATCTTCAAACAGAAACCCTTACACATTTAATTAAAGT
TAGCTCTTTTTTGATAATAAAATGAGTAGCATCTCTGAAGAAAATGAAGATGATGAAAAC
GAAGAAGGAGAAGAAAAGAAAATTGATTTATTTGGAACTGATATACAAAGAGAAAAGAAG
AATAACAATCTCAGCAAGTTCTTTGCATCTCACTTATTCGATTTTAGCTAAGTCAATAAA
AACTCAACAAACAAAATTAGATATCAGGACTCAAAAGAAGGAAAAACATTAACTAATACT
GTTGACATAAAGAAGAGATAGCAACAGTTATTTTTTGAAAATCAAAATAGAATGAGAAAA
CAATAATTACAGACAATCAGAAAATATAAAATTGGTGAATTACCTGATATTGGTATCCTT
TACAAGGATATTATTGATCCTCTGATGGCTTTGAGTTTCATCGATGAAACCTTAGCTGGA
TAATTATTCTAATTACTATTACATTCTATGTTTATGAAAGAAGAGTCTGCTGATAGATAA
CAAAAGCTAAAAGATATTTTATCTAACATTTTAGCTAAGTCAATTGTTCATGATTTCAAT
TTCGTTTCAACTATTCATAAAACTATGATTATGCTAACTAAAGAAGGTGAGTTGTTTGAT
AGTAATATAATTAAATAAAGTGGGTTGCTTAGTCATAGCTATTACACATCTATCCTGCTA
CTGGAAGAAAGTCTTTTCTCGTTATTCCATAGGATAGATTAAAATGAATAGGCTGGTGAT
AAAGATGTTCTGAAGAAAAGAAAAGAAATTCTTAAAAATAACTAGAAGAAAGCTTCCAGG
GCTAGAGGAAGAAAGGAAATGCAAATAGGTGAAGATGATTATGAAAAAGATTTAGATGAA
AATGAAGAAGATCTTGAAGAAGAAAGACTCTTATATGAATCTAGAAAAAAATAATCTGAG
AAGAAAAGATTAGAAGTGAATTATTGGATGGATTTAATTGACATCTATTCTCATCTAAAT
GAAAAAGATCAAATCAAAGGCATTCTTAAAAAAACAGTTTCACACGAGGGATAAAAAGAT
ATGATTGTTGCACTCGATTTGAAGTTCTCAGGCTAAATATAAAATTCTTTAAAAATATTG
AAAGAAATTAGCTCTAAAAATAAAGAAAGTGAAAGATAAAATTAATTTAGAATGGCAATA
GAAGATAATTTGAATAATTAGGTTAGTTTAGATGATAGAATTCAAGAGTATATTTAAAGT
GAATATCAAGACACACTTGCATTAATGGGAAAATGGGATGATCTTGCAAATGAACTAATT
GAAATCAATAAAGATGTTCTTGAATAACCAGAAAAAATAGGAGTAGAGAAAATGAAAATA
CTTATGCTTTCTCTTATGTAATCTGACTCAGCTGACACAAGTAGGTGGGAAGAGTTGAAA
GATTATGTAAAGCTTTGGATGAATACAGAATATGGTAAAAGCGTTTTAGAAGGTCCTCTT
AGCTATGAAATGGCTCTAATAACAATTTTAGATGGTGATATTGATAGGACGAGATATTAT
CATAAATTGAGTTAAAATCAATTCCTGAGGGTTTGGAGTAACTTTGGTAGCTTTGCTACA
GCATCTAAGCATGAATATCTCTCTAATATTTATAAGAACTACGAACTTAAGGAATATCTC
CATCTTGATGGCAAAATAGAAGCAACTTATGAAGACTTTAATAGCTTATTCAAAAACTGG
TAGAATAGAAAACCTTCTAACACATACGATAATTAAATTTGCTGGGACTAGATACTAAAT
AGCAGAGAGATATTTGCTTTAGCTCTCTACTAAAAGTATAATTTGGAAGATTAGTTTGTA
AATAAAATAAGGTCTAATTGGTATATTCAAAATGTCAAAGGTATGCTTAAGAAAGGAATA
CACGGAGCTGCTGATAGAAAAATGAAAAAAGCAGCTGGCTATAGAAAAGTTATGAATGGG
TTACCTGAATTTAATTGGGACTACTACAAAATCACTTCAAAATTGAAACTTAAATAATTG
GAAGTAGATTTAAAAAATGATTAAATCCCTGAGAACCCCTTTGAGAAATTCAGCAAACTG
ATAAAAATTTTCGAGTAAGAGAAGGAGAAGTATATTCATTAACTAGACTAATCTCAAATA
GTTAAATTCGAACAGCTTAATATTTAAGTGAACGAAAAATTCATTGATGTTTATTAAGAT
TATACCCTCACTCAAATAGTTGAAGACATTTTCTTAGAAAAATATGCAGATGTGATTAAT
AATATTTACTGGGGATATAATAAACTATTTTAGAATGATATAATGAAAAAAGATATAGAC
TTATCTAGCTAGAGCTAATCGCTTAGTTAACCTTTTGAAAATACTTTTTCTTTTAAAGGA
CCAGCTTCTCTTCCATAGATGGCTGGAAATAATAATTTCAACAGCAGTGAATAAATTTTT
GAAGAGATCATTCCAATGAGGTTAAAGAGTTACAAAAGATTTGCTAATTTTTGTGAATAA
CTTTTAAGAATCATTGAGTCTGAGAGCAGAGATCACTTAAAAAAGACTTTGAAAGTTTAA
TATTAGCTAACTGTTGAGACTGTTGGCAGTTCTTTCTTGGAATACACTCTCAAGTGCTTT
TCTTTAATGGGAGGAATTAACTAATTTGAACAAAAGTCAAATAAAATGTAAATGGAAGTA
GAAACAGGAGAAAAAATATAAGAAAATCCTGAAAAGAGCTAAAATCAGTCAATTGAATTT
GATTAGAATATGTCAAATTTAGTGCTAAAAATGTTAAGAATTATTTAACAAATCCCGAAT
ATGACAGGCTAAAAGTTTAAGGAGGCCATAGAATTACAAATTATTCCTTCATGGATATTT
ATTAGCTTCTTGCCTTAAATGATGCACATTTTAAAGAAATAGAATTTAGTTGAATTTTTC
GAACCTTTGATTAAAAAGCTTGCCAAAAACTATCCTGAGGCATTAATTTACTAGTTTAAT
ACTATATTTAGCAACTAAACAACGTGCGAAACGGCTTTATCTTAAGAAATATATGAAGCA
TTACACAAGGAAATGCCTCATTATTATAATTTTATGTACCATTTGAATCAAATAACTCAC
CCTGAGCATCGTTTGATTTACTACCTTGAATACCTAAAGAGCTAATTTTTATCATTTTAG
AAAATTCACAACACCTATAGCTCCTAAAAAGATTATGTTAAACTTAACAAGGCTGTTGAA
GAATATCAGAAAATTATTGATAGAATTTTAAAAGAAACAGAAGAGGATTTGTTCTAACAT
AATATTAATGCAGATCATATGGGAAGTTATAACATCAAATTTTCAAAGGATCATATTAGC
GAATTCAAAAAGCTTGTTAAGAAATTTACCGACATAACAAAGGGAGATGACTAAGATAAA
AAAGAAGCCTATGATTTCATCAAAAAATTCAGAGATAAAGTCAACACAAAAGATCTCAAA
TCAGGCTATGACAAACTTTCTAATTTTTCAAGTTTCCTATAAAACTTCTAAGCTGATCAC
ATTATTGAAATTCCTGGGTAATACACTTCTGGAGCAGTTATTACTGAGCCATACAAAGAG
TCACACATTAAAATATAAAGTTTTGATTCATAAATTCTGACTCTCCAATCAATTCGTCGT
CCCAAAAGACTCTGTATATATGGCTCTGATGAAAAATGCTATAAATTTTTAGTAAAGGGG
ATTGAAGATTTAAGACTAGATCAGAGAATAGAGCAACTGTTTTAAGTTATGAATAATATT
TTCGAATATGATCCTTAATGTCAGTCTAAAGAGCTGAACCTTTCAACTTTCAACATTATT
CCGATGACGAACATCTTAGGTTTACTTGAATGGGTTGATAAGACAAGCGTTTTAAAGGAA
ATATTAAACAAAGAATTTTAAGAAAAAATGGGAAGCAAAGAAGACATTGCTTAAGACAAT
GAAGGGTTGAGAATGAGAAGAGAATGGCTTAAGCAACTAGACAGAAAAGGAGGTTTGGCT
GAACAGCATATAAAACTATAATTAGAACCATCAGACAAAATCGAATAAGCATTCAATGAA
TAGGCTGATTTGATTCCAAGGGATGTGTTTAGGAATGCGCTTGAAAGACTAGCTTCTACT
TGTGAAACCTATTTGTACTTAAAAGAAAGATTTATAAGAAATTATGCTGTTGTTTGTGTT
TCAGGATATATTCTTGGTATTGGTGATAGACATTTAGAAAATTTCTTAGTAAATTACTCT
AACGGTGATATAGTTTCAATTGATTTTGGTTACAGTTTTGGTGCTGGTCTAGGACTTGCT
GTCCCAGAGCTAATGCCATTTAGATTGACAAGGTGCTTTACAAATTTAATGAGTCCTATT
GGAATTAATGGAATCTTTAGATAATCAATGATCTCATCAATGATGGCTTTAAAAAAGAAA
AGAAACATCTTACTTGAATTCTGTGAAGTATTCATAAACGATCCTTTGGTTGATTGGGTT
AAGCTTACAAAAGACAAAAAAATGGGCACAATTATGTTTAGTGAGAATATTGGGCATTTA
GATTCCACCAAGACTTATAACGCAGAGCAGTCATAATCATAATAACAGTATGGATTAAGT
ACTATGGAGGCTAGTCAAATTGCTGATCTAATGATTCATATGTAAAGAATTGATATTGTA
AAGCTAAAATTAATTGGAATGAATCCTTCTCATTTATTTACTGAAGAGTTATCTTCAACA
AGACATAAAACTGGAAACTACTTTTAGCATTTAAAGTCTGCTTTAAAGGGAAAACCAAAA
TCGATTAGAAATCAATATAACGAAAAACAATTTTTAGAAGTACATGAACAAGTAGATTGT
TTGATAGATTTGGCTGTTGACCCAAATATTATAGGAAGAGTTTGGATTGGATGGGCACCA
ATCATATGA


>TTHERM_00203010(protein)
MLEHLLESALIKLYQGNFTDSKQIVQAISDILLDETLDDSQISLCNSKIFNSDLNLFTYL
ENNRTYKDNLQAQIRKGLFRTIAAYIKLRKLKVFEYIELICKNCMSLFKKEESNQAKETS
LSPIIKIIKCIDNSELLEKIIDPKNTISALLNEIKFCKPTQKVKGSIWNLIGIIFQFFTD
QLEDDLKAEIQTVCFKELQVQMASQKPEVSYVSGMFKSFRYSLKEIHLSNKELEDLYKMI
KIGITEIKDVKTYSVINNALKVLTAYSHIFKVQILDDSKEIIDKVLGLISHNNRDVKENA
SDCLESLMALLAIELDSSYKNHELSFNYIIQKMSFLINQERQQIYTASITVIIKSIGIFS
KAIAKHLGQDQLQLFFKQMINLSEVRLLKHIEKDGVNSVVDFQPVEDETMKKGTSFKTIL
YRQKQVISFITSFANIISQLDKLYEDESQSLLRLCMVGFKQFSSFYEKYKEPLNEGIVQL
MREMKKHQSIYIIWLENLVQNGLVQSIKLPDNSFLSMQEYYETLKSCSQFWKSLFNCQLW
TDETLHHFSAQFFQYIIQLLENTDLSYKVVYTQQIEEDEIKDKNQMEIEQDKESKIQDII
REIQQVQYVANNEVDLQFFYRNLGKYQDELLIDCLKTMLSIPFEVLLIDNYSFFRKNLIV
ALKKGFELGVQNVSMGFAAIECLQKIIKRSKNRVVFKYLKLVIPYLSEYLSITKGELEEI
TSDMKYKVQSNNQQRDIFNLTVSELGQRKKDLIERVTNLLGDIGGESHLIVLSEKGFQGN
VERQLLSEFENLQISKKGVSLISWDYEAKVLFPLPLLAKKIDINLTKLLPRMVELTLNPD
DKIKVYACEAIHAITIYMIGTQASSIQGGQKKRGRDMENLIKSKEEFSKIYSKLFPTIFS
IGSNSSHPSCQLMNQLILQISRWFANSKQLESPEVAELLDNIMNFISSKDNNNLRELAAN
CLGQFIKWTLKQNTEQEIKVNHSNIKSALRRIISFSGQPDLSKRFGALLALKEVVNNIKN
ESFLVDKFIMETIQTSMRIVQKTGVSNEVEDNFNILIKLQTNIIQKNYKTLKAKNENRSG
QFKLLDSLLDWLYSYGFFNSSYLVRKSSFELWQSILNREDSDISCKKFLAKRKQGDNLFG
DQIKQLKLAINSQSYFREINVLLSQLDVVTFIVKNNFFSVQEELLQFEDIIDSFCTNIEN
FFNSLFKIQESYLKSDGLLMEILLDDAVDIDIQENQYQAVINLFIKICEFMSLLSNDILN
FTTFLDVLLNITLENKYSIFLQMLLKPNHLIRGMNIDIFLTKSELYFEKITPVIKALQEI
TQEGVDFFQDYVLKALEDIFKGNKPQKFEEIISDEQKLKENELKIFLEGIKLIFKLCSQS
SRYTIRYIEKAISGILNGVKSSEENILNKQDSLFRESRTQQIFQFALDISSESTNEFILQ
IISQQSQFFQKYENQLLTYVKSKWNLIGQKYLMLAKDNISLLKLTIPLLQSIIQSFNRKE
KEESLLILIQNLPVINIERKEDTFLEIELKLNWLIMSSIEGLVIEKNYSDYVEKLIEVSL
KVEKSLFIHEQGFNLLGFYLKCINNADFFVKRGLRDKVNSVRSKYFPMKVKELKRDSKQE
IDFKSILGCMINMIKLAGQIELLEILFPVIRESLEEPYHTKIITFIQQFIKENFMTQTVN
KQLYFMEWALDQYKDKDLDRSLLECIRYEIIQKVLLHLIENAKEEANVKFMVKNSPYLEK
LFYNTDFMKQENMKEVLRWVQELIQVFNIFESLYKALSLDKIKDDVHKKLYPDTTQGNEL
TKSLIKIAFEYRKKGFERADDIKNNVQNNPDLIGIDSHSILRLFSCAVYNCLSQIITKTQ
NKENILNQFLFQQKNDHLWDLLIDGTQKEFNFEIETNFEERSYARTRNIFSRIPKFDTKE
ILCKKYLNETVLCTFNKTSASQAFLPSFANELISKNSEHDIYEDEEDESENIIQETKKYM
QQQQNLFFGDQTGENLEMDLINRHPCMPTVLTNIDKMVQQFPLTEAMPQWMTNLLEEVKK
DSCSLGQKIFIIKIVLNKPLLFEKYSQQWFDVLVDYAKLNDNGSKFFHYFLRDVTTTLID
WCSKKPNLVTRRIASDKKQNLCQVINKICRVLAHKEKEIFKQNIQILKNLLDLWKECIYV
DENQLTKMLLLEDKEDKEKSQLWNLNSILILDACIQLRIPILSNYEAFSRAQTVEEKFAF
FLNISEKDRLKRLLLFQQHSKRQYCKAASAVCGGLLSMMHEYGGQFEGKRKIYEQEIVNN
SVNIINKTDKTSKERFPIIVACITQYYPDFLNNIKIITYCQDYIHQKSKMDRAYILQSIL
IFLKKKLDKRENMKEDIHKICTSFRGVVQNVAEDENVENQEKFLSLFVFLSSPQILNSFD
DAIQLMRISISILKQKYERHYQEKFATAYYTIVYNLYDYLINQESDLKDKNQINESEEMN
QFKSQVKSCILCGLTSQHNTIRENTFKFLDRETNDSKTPYERLLYLIQEIYQPEQERLWL
LSAVPLIMCLSKRTSDYDKNLFDEQLSKLAQFYDWDFRDSHNMRLYNSSQPLTPLYTLSQ
VNYKDSQGFAIPAPRRMYNITGVSQMPIQEGVRATVYSQSQDNSQGEMVIPSQDQASQMN
QLEEKRQIYQDQMKRLVNPSQQISSSFSSSNRNPYTFNQSQLFFDNKMSSISEENEDDEN
EEGEEKKIDLFGTDIQREKKNNNLSKFFASHLFDFSQVNKNSTNKIRYQDSKEGKTLTNT
VDIKKRQQQLFFENQNRMRKQQLQTIRKYKIGELPDIGILYKDIIDPLMALSFIDETLAG
QLFQLLLHSMFMKEESADRQQKLKDILSNILAKSIVHDFNFVSTIHKTMIMLTKEGELFD
SNIIKQSGLLSHSYYTSILLLEESLFSLFHRIDQNEQAGDKDVLKKRKEILKNNQKKASR
ARGRKEMQIGEDDYEKDLDENEEDLEEERLLYESRKKQSEKKRLEVNYWMDLIDIYSHLN
EKDQIKGILKKTVSHEGQKDMIVALDLKFSGQIQNSLKILKEISSKNKESERQNQFRMAI
EDNLNNQVSLDDRIQEYIQSEYQDTLALMGKWDDLANELIEINKDVLEQPEKIGVEKMKI
LMLSLMQSDSADTSRWEELKDYVKLWMNTEYGKSVLEGPLSYEMALITILDGDIDRTRYY
HKLSQNQFLRVWSNFGSFATASKHEYLSNIYKNYELKEYLHLDGKIEATYEDFNSLFKNW
QNRKPSNTYDNQICWDQILNSREIFALALYQKYNLEDQFVNKIRSNWYIQNVKGMLKKGI
HGAADRKMKKAAGYRKVMNGLPEFNWDYYKITSKLKLKQLEVDLKNDQIPENPFEKFSKL
IKIFEQEKEKYIHQLDQSQIVKFEQLNIQVNEKFIDVYQDYTLTQIVEDIFLEKYADVIN
NIYWGYNKLFQNDIMKKDIDLSSQSQSLSQPFENTFSFKGPASLPQMAGNNNFNSSEQIF
EEIIPMRLKSYKRFANFCEQLLRIIESESRDHLKKTLKVQYQLTVETVGSSFLEYTLKCF
SLMGGINQFEQKSNKMQMEVETGEKIQENPEKSQNQSIEFDQNMSNLVLKMLRIIQQIPN
MTGQKFKEAIELQIIPSWIFISFLPQMMHILKKQNLVEFFEPLIKKLAKNYPEALIYQFN
TIFSNQTTCETALSQEIYEALHKEMPHYYNFMYHLNQITHPEHRLIYYLEYLKSQFLSFQ
KIHNTYSSQKDYVKLNKAVEEYQKIIDRILKETEEDLFQHNINADHMGSYNIKFSKDHIS
EFKKLVKKFTDITKGDDQDKKEAYDFIKKFRDKVNTKDLKSGYDKLSNFSSFLQNFQADH
IIEIPGQYTSGAVITEPYKESHIKIQSFDSQILTLQSIRRPKRLCIYGSDEKCYKFLVKG
IEDLRLDQRIEQLFQVMNNIFEYDPQCQSKELNLSTFNIIPMTNILGLLEWVDKTSVLKE
ILNKEFQEKMGSKEDIAQDNEGLRMRREWLKQLDRKGGLAEQHIKLQLEPSDKIEQAFNE
QADLIPRDVFRNALERLASTCETYLYLKERFIRNYAVVCVSGYILGIGDRHLENFLVNYS
NGDIVSIDFGYSFGAGLGLAVPELMPFRLTRCFTNLMSPIGINGIFRQSMISSMMALKKK
RNILLEFCEVFINDPLVDWVKLTKDKKMGTIMFSENIGHLDSTKTYNAEQSQSQQQYGLS
TMEASQIADLMIHMQRIDIVKLKLIGMNPSHLFTEELSSTRHKTGNYFQHLKSALKGKPK
SIRNQYNEKQFLEVHEQVDCLIDLAVDPNIIGRVWIGWAPII


>TTHERM_00203010(gene)
ATGTTAGAGCATTTACTTGAAAGCGCTTTAATAAAGCTTTATTAAGGGAATTTTACTGAT
TCTAAGCAAATAGTTTAAGCAATTTCAGATATTTTATTAGATGAAACTTTGGATGATTCA
TAAATATGTATAAACAAATTGTTTTTTTAAATCTTACTACAATGATTATCACTAAATAAA
TGATAATCTTTATCATTTTACTAAACTAAAATCTTATAAATAATTATTTTAACACTTAAA
TTTATTTTTTTATCAATTAAAAAAGCTCTATGTAACTCTAAGATTTTCAACAGTGACCTC
AACTTGTTCACTTATTTGGAAAACAATAGGACATATAAAGATAATTTGTAGGCTTAGATT
AGAAAAGGATTATTTAGAACAATAGCAGCATATATTAAGTTAAGAAAGCTCAAAGTATTT
GAGTACATTGAGCTAATATGTGTAAAAAAAATAATATTACTATTAAAATATTAATTCTAT
TTTTGAAATTAAACTATGTAGAAAAATTGTATGTCCTTGTTTAAGAAAGAGGAATCAAAT
TAGGCAAAGGAGACATCGCTTAGTCCTATTATCAAAATTATTAAATGTATAGATAACTCA
GAGCTATTAGAAAAAATAATTGATCCTAAAAATACGATATCAGCTTTACTTAATGAAATT
AAATTTTGCAAGCCAACTCAAAAAGTGAAAGGATCAATATGGAACTTGATAGGAATCATT
TTTTAATTTGTATGGAAAAATATATAAAATTATTGATAATAAAATACTAATTAGATTTTC
TAATTAAATAAAGTTTACTGATCAACTAGAGGACGATCTAAAAGCAGAAATACAAACTGT
TTGTTTTAAAGAACTATAAGTTCAAATGGCAAGTTAAAAGCCTGAAGTATCTTACGTTTC
TGGCATGTTTAAATCATTTAGATACTCATTAAAAGAAATTCATTTGAGCAACAAGGAATT
GGAAGATCTTTATAAGATGATTAAAATTGGCATAACAGAGATAAAAGATGTGAAAACATA
TTCAGTTATTAATAGTAAAATAATACTTGATAAAAATATTTTAAATTTCATAAATAAATT
TTACAATTTAGATGCTTTGAAAGTGTTGACAGCTTATTCTCATATTTTTAAGGTTCAGAT
ATTAGATGACTCAAAAGAAATTATTGATAAGGTGTTGGGATTAATTAGCCATAATAATAG
AGATGTTAAGGAAAATGCATCTGACTGTCTGGAATCATTAATGGCACTACTTGCAATTGA
ACTAGATTCAAGTTATAAGAACCATGAGCTTTCATTTAACTATATTATCTAGAAGATGAG
TTTTCTAATAAATTAAGAGAGATAACAAATATATACTGCTTCAATAACAGTCATCATAAA
ATCTATTGGTATTTTCTCTAAAGCTATAGCAAAGCATTTAGGCTAAGATTAGCTTCAATT
ATTTTTTAAGCAGATGATCAATCTTTCTGAGGTTAGATTATTAAAGGTAATTAATTAAAT
TTATGGTAAGATAATATTTTTCTAATTGTTAATTGGAATTAAAAGCACATAGAAAAGGAT
GGTGTTAATAGTGTTGTTGATTTTTAACCCGTTGAAGATGAGACTATGAAAAAAGGAACA
TCATTTAAGACTATTTTATATAGATAGAAATAAGTCATCTCTTTTATTACCTCCTTTGCT
AATATTATCTCATAATTAGATAAATTATATGAAGATGAGTCTCAGAGTCTTTTGAGATTA
TGCATGGTTGGATTTAAGCAATTTAGTTCATTCTATGAGAAGTATAAGGAACCACTTAAT
GAGGGAATAGTTTAACTGATGAGAGAAATGAAAAAACATTAATCTATATATATCATCTGG
CTTGAAAATTTAGTTTAAAATGGACTTGTGTAGAGCATAAAATTACCTGACAACTCTTTC
TTGTCTATGCAAGAATATTATGAGACATTAAAAAGTTGTAGCTAGTTTTGGAAGAGTCTT
TTTAACTGCTAGTTGTGGACTGATGAGACTCTACACCATTTCTCTGCTCAATTCTTTTAA
TATATCATCTAGCTTCTCGAAAATACAGATCTAAGTTACAAGGTTGTTTACACTTAGTAA
ATTGAAGAAGATGAGATAAAAGATAAAAACCAAATGGAAATAGAATAAGATAAAGAAAGC
AAGATCTAAGATATTATAAGTAAAAATAAAAATTTTATTTCAAAGTAATTTTAAAACATA
TAAAATTGTATAGGGGAAATTCAATAAGTTTAATATGTTGCAAATAACGAAGTGGATTTG
CAATTTTTCTACAGAGTCACACTGCTTTTTGACTCAGTTCTTCCTTCAATTAAACCTGCA
CTATTTTCAAATTATATATATCAGTTCTACAAATCTATTATCCTTAAACTTAGAAAGCTA
CCTAGATCTATTGTACTATTGAAGCTTCTTAGGTGTTTGAATGAGTACATTGAAAAAAAT
AATATCTTAAAAGGACTTAAAAAGTATATTAAGAAAGATATCACTAGCTAAATTAAAATA
TTTTTCTCAGAACTGTACAAGGTAAAATAAATTATTTAGTAACAAAGTTAAAATTTTATT
TAGAATTTAGGAAAATATTAAGACGAATTACTCATTGACTGCTTAAAAACTATGCTTAGT
ATTCCATTCGAAGTGCTCTTAATAGATAATTACTCTTTTTTTAGGAAAAATTTAATTGTA
GCTTTGAAAAAAGGCTTTGAATTAGGAGTGTAAAATGTTTCTATGGGTAATAAATTATTT
ATGTTTGTTAAAATATTTTTTTATAAGATAAAATTTTAAATATTAGGATTTGCAGCTATT
GAATGCTTACAGAAAATTATAAAAAGAAGCAAAAATAGGGTTGTTTTTAAATATTTAAAA
CTAGTCATTCCTTATCTTTCTGAATATTTATCAATAACAAAAGGAGAACTTGAAGAAATT
ACTTCTGATATGAAATATAAAGTACAAAGTAATAACTAGTAAAGAGATATCTTTAACTTA
ACAGTTAGTGAACTAGGCTAAAGGAAGAAAGATTTAATTGAAAGGGTAACAAACTTACTG
GGTGATATCGGAGGAGAATCTCATCTAATTGTTCTTAGTGAAAAAGGGTTTTAAGGAAAT
GTTGAGAGATAGCTTTTAAGTGAGTTTGAAAATTTGCAAATTTCAAAGAAGGGTGTTTCT
CTTATTAGTTGGGATTATGAAGCTAAAGTTCTATTCCCTCTTCCACTACTAGCAAAGAAA
ATAGATATAAATTTAACTAAGCTTCTCCCTCGTATGGTAGAACTCACTCTTAATCCTGAT
GACAAAATTAAGGTATACGCATGCGAAGCTATTCATGCAATTACTATTTACATGATTGGA
ACTTAAGCATCATCAATTTGTATTTAAAATTATTTAACATTTTAGCTTTATTAAAAATAT
TTTTAATATATTTAGAAGGAGGATAAAAGAAGAGAGGAAGAGATATGGAAAATCTAATTA
AGTCAAAAGAGGAATTCTCAAAAATATATTCTAAATTATTTCCTACAATTTTTTCTATTG
GAAGTAATTCAAGCCACCCAAGTTGCTAGTAATTATAAAATAATTAATTTATAATTTTAA
TTTTATTTAAATAATTTAAACAGGTTAATGAACTAGTTAATACTCTAAATTTCACGTTGG
TTTGCTAACAGCAAATAACTAGAGTCACCAGAAGTTGCAGAACTATTAGACAACATTATG
AATTTCATCTCTTCAAAAGATAATAATAACTTGAGAGAACTTGCAGCAAATTGCTTGGGT
TAATTCATAAAATGGACTCTGAAGCAAAATACAGAATAAGAAATTAAGGTAAACCACAGC
AATATTAAGTCAGCTTTAAGGAGAATTATTTCTTTTTCAGGTATTTTATTTAAACTTGTT
AGATTTAATTATTTTAAATTATTTTTTTTATATTTATTATATTTTGAATAAATGCTTATT
TTTTTATTTTATTCCCCTTTTATTTATTTTAAATGTTATAAATTATTTTAACTAATTAAA
GTTTTTTAAGAAAAATTTATAAATAATAATTTTATTCCAGATATAATCATTATGAGTGCT
AACATTATTGGAATTTTTTGATAAAATAAAAATGATTCAAACAAAAATTAAGCCGAAATA
AATTTTGTATTTTATTTTATTAAACTACCTCAACGAAGCTTTAGTACTGAAAATAATACA
TTCAAAAACAACAAATTGTTTTGATTTTTTGAATATATTATTTAAATTTTTACTTTTTAA
TTTTAATAAGGATAACCTGACCTTTCTAAGAGATTTGGTGCTTTGCTTGCTCTAAAAGAA
GTTGTTAATAATATTAAAAATGAGTCATTTTTAGTTGATAAATTTATAATGGAGACAATA
CAAACTTCTATGAGAATTGTATAAAAGACGGGTGTAAGTAATGAGGTTGAAGATAATTTC
AACATCTTGATTAAGTTATAGACAAATATTATCTAAAAGAATTATAAAACTTTAAAGGCA
AAGAATGAAAACAGAAGTGGATAATTTAAACTGTTAGATTCTCTTCTTGACTGGTTATAT
AGCTATGGATTTTTTAACTCGTCATATTTAGTTAGGAAAAGTTCTTTTGAACTTTGGCAA
TCTATTCTTAACAGAGAAGATTCTGATATAAGCTGTAAAAAATTTTTAGCTAAAAGAAAA
TAAGGAGATAACTTGTTTGGAGATTAAATTAAATAACTAAAATTAGCCATAAACTCATAA
TCCTACTTCAGAGAGATAAATGTTTTACTATCTCAGTTAGATGTAGTGTAAATAATAATT
TTAAATTTTTTATTAAATTAATTAACATAATTTTGATTTCAACGAAAAAAAATAAAATTA
TTTTAAATAGAACTTTTATCGTTAAAAATAACTTCTTCAGTGTATAAGAAGAGTTACTTT
AATTTGAGGATATTATAGATTCCTTTTGCACTAACATAGAAAATTTCTTTAACTCTTTAT
TTAAGATATAAGAGTCGTATTTAAAGTCTGATGGATTATTGATGGAAATTTTACTTGATG
ATGCAGTTGATATTGACATTTAAGAAAATTAATACTAAGCAGTTATTAATTTGTTTATTA
AGATATGTGAATTTATGTCTCTACTATCTAACGACATACTAAATTTTACTACCTTTTTGG
ATGTACTTTTAAATATCACCCTTGAAAATAAATACTCAATATTTTTATAGATGCTCCTCA
AACCTAAGTATTTAATTTATTGTATTAATAATCGTTTTTATTTGATTTATTTTTGATATA
AATTAGTCATTTAATAAGAGGTATGAATATTGATATCTTTTTAACAAAGAGTGAGCTTTA
TTTCGAAAAAATAACTCCTGTTATCAAGGCACTATAGGAGATTACTCAAGAAGGAGTTGA
CTTCTTTTAAGATTATGTTTTAAAAGCCTTAGAAGATATTTTTAAAGGGAATAAACCATA
AAAATTTGAAGAAATAATTTCAGATGAATAAAAGCTCAAAGAAAATGAGCTAAAAATATT
CCTTGAGGGTATAAAATTGATTTTCAAGCTATGCTCATAATCTAGCCGTTATACAATTAG
ATATATCGAAAAGGCTATCTCAGGAATTTTGAATGGGGTTAAGTCTTCAGAAGAAAATAT
TTTAAATAAGCAAGATTCTTTATTTAGAGGTAATTTCATTATTCAATATTTTTATAAATA
AAAAATCAAATATTATAAAACAGAAAGCAGGACTCAACAAATATTTTAATTCGCCCTTGA
TATAAGTAGTGAATCTACAAATGAATTTATATTGCAAATAATTAGCTAATAAAGTTAATT
CTTCCAGAAGTATGAGAATTAGCTGCTTACATATGTTAAAAGTAAGTGGAATCTTATAGG
ATAAAAATACTTGATGCTTGCTAAAGATAATATCTCCTTATTAAAGCTGACGATTCCTCT
TTTATAGAGCATTATTTAATCTTTTAATAGAAAAGAAAAGGAAGAAAGCTTGCTTATTCT
CATATAAAATTTACCAGTTATTAATATAGAAAGAAAAGAAGATACCTTCTTGGAAATTGA
ATTGAAATTAAACTGGCTAATTATGTCTTCAATTGAAGGTCTGGTAATTGAAAAAAATTA
TTCAGATTATGTTGAAAAATTAATTGAGGTTTCTCTTAAAGTTGAAAAAAGTTTATTCAT
TCATGAGTAAGGATTCAACTTGCTTGGGTTTTACTTGAAATGCATAAACAATGCAGACTT
CTTTGTAAAAAGGGGTCTTAGAGACAAAGTAAATTCAGTTCGTTCAAAATATTTCCCTAT
GAAAGTGAAAGAATTAAAAAGAGATTCAAAGCAAGAAATAGACTTTAAATCTATTTTAGG
ATGTATGATTAACATGATCAAATTAGCAGGATAGATTGAGTTGCTTGAAATACTTTTCCC
TGTTATTCGTGAAAGCTTAGAAGAACCTTATCATACAAAAATAATAACATTCATTCAATA
GTTTATTAAAGAAAATTTCATGACCCAAACCGTTAATAAACAACTCTATTTTATGGAATG
GGCATTAGATCAATACAAAGATAAAGTAATTAAAATACTTATTTCAAATCATTTTAACTA
TTTTCAATATTCATTTATTTAGGATTTGGACAGAAGTTTGTTAGAGTGCATCAGATATGA
AATCATTTAAAAGGTATTACTCCACCTTATTGAAAACGCTAAAGAAGAAGCTAATGTCAA
ATTTATGGTAAAAAACTCACCCTATCTAGAGAAATTATTTTACAATACAGATTTTATGGT
AAATTTTTATTTTATTTTTTAATTTTTTGTATTTTTCTTTCTTTAATTGAAATAAAATTT
TAAAGTAGATCTTTGATTTGATTACCTAAAAATATTTTTAGATAAGTTTAATATGTAAAA
TTTAATTTAATTTACTTTGAGTTTAACAGAGTTGCTAAAGCATTTTAGGAAAAACATTTA
ATTTTTCTTATTGATAAAAATCAATTTTTTTATCTTTTATTCAGGTTTAACAAAAATAAT
ATTTAAAATAAATCTTAAATATTTTAGAAATAAGAAAATATGAAAGAAGTTTTGAGATGG
GTGCAGGAACTTATTTAAGTCTTCAACATATTCGAAAGTTTGTATAAGGCTTTAAGCTTA
GATAAAATAAAGGATGATGTGCATAAGAAATTATATCCAGATACTACATAAGGCAATGAG
CTGACTAAGAGTTTAATAAAAATAGCATTTGAGTACAGAAAGAAAGGATTTGAGAGAGCA
GATGATATAAAGAATAATGTTTAAAATAATCCTGATCTTATAGGTATTGATAGTCACTCA
ATACTTAGATTATTCTCTTGTGCTGTTTATAATTGCTTATCTTAAATTATCACAAAAACT
TAAAATAAAGAAAATATCTTGAATTAATTCTTATTTTAATAAAAGAACGATCATCTTTGG
GATCTTTTAATTGATGGTACTTAAAAAGAATTTAATTTTGAAATAGAAACTAATTTTGAA
GAAAGATCGTATGCTCGTACCAGAAATATTTTTTCAAGGATTCCAAAATTCGATACAAAA
GAAATTCTTTGCAAAAAATATTTAAATGAGACAGTTCTTTGCACTTTTAACAAAACTTCT
GCTTCATAAGCATTTTTACCCTCTTTTGCAAATGAGTTGATTAGCAAAAACAGTGAACAC
GATATATATGAAGACGAAGAAGATGAAAGTGAAAATATTATATAAGAAACAAAAAAATAT
ATGCAGTAACAATAAAATTTATTTTTTGGAGATTAAACTGGAGAAAATTTAGAAATGGAC
TTAATCAATAGAGTAAATTTCTTAAAATATACAATAACTATAAAAATATATTTTAAAAAA
GCATCCTTGTATGCCTACAGTTCTCACAAATATTGATAAAATGGTTTAATAGTTCCCTCT
TACTGAAGCTATGCCCTAATGGATGACTAATTTATTAGAAGAAGTCAAGAAAGATAGTTG
CAGCTTAGGTCAAAAAATATTTATAATTAAAATTGTTTTGAACAAGCCATTGTTGTTTGA
GAAATACTCATAACAGTGGTTTGATGTGTTAGTTGATTATGCAAAATTAAATGATAATGG
TTCAAAGTTCTTCCATTACTTTTTAAGAGATGTCACTACAACATTAATAGATTGGTGTTC
TAAAAAACCTAATTTAGTAACCAGGAGAATAGCTTCAGATAAAAAGTAAAATCTATGCTA
GGTTATAAACAAAATATGCAGAGTAAATTATTTAATTTTAGAAATATTATAAATAATTAT
GATTTTAATGACTTAAATTATAGGTTTTAGCTCACAAAGAAAAAGAAATCTTTAAATAAA
ATATTCAAATTTTAAAGAATTTATTGGATTTATGGAAAGAGTGCATTTATGTTGATGAAA
ATTAGTTAACAAAGATGTTATTGCTTGAAGATAAAGAAGACAAAGAAAAATCATAGTTAT
GGAACCTAAATTCTATTTTAATTTTAGATGCTTGTATTTAATTAAGAATTCCTATACTTT
CTAACTATGAAGCATTCTCAAGAGCACAAACTGTAGAAGAGAAATTTGCTTTCTTCTTAA
ATATATCTGAAAAAGATAGACTCAAGAGACTATTATTATTTTAATAACACTCTAAAAGGC
AATACTGTAAAGCTGCATCTGCTGGTAATAAAGTTTTCTTTTTAATATATCTAAAATGAT
TCTTTACTAAAGTTTACATTTAATTATCTATTTATTTATTAATTTAGTTTGTGGAGGCCT
TTTGTCTATGATGCATGAGTACGGTGGTTAATTTGAAGGAAAGAGGAAAATTTATGAGCA
GGAAATAGTGAATAATTCTGTAAATATTATAAACAAGACTGATAAAACTAGCAAAGAAAG
ATTCCCCATTATCGTTGCCTGCATCACTTAATACTACCCAGACTTTTTGAATAATATAAA
AATTATTACCTATTGCCAAGACTATATCCATTAAAAAAGTAAAATGGACCGTGCTTACAT
TCTACAATCAATTCTAATTTTCTTGAAAAAGAAATTAGACAAAAGAGAAAATGTAAATTA
ATTAATTATTAATTAATGTGTATTTAAATTTTATTAATTAAATTTTAGATGAAAGAAGAT
ATCCACAAAATTTGTACTTCTTTTAGAGGAGTTGTTTAGAATGTTGCAGAAGATGAAAAC
GTTGAAAACTAAGAAAAATTTTTAAGTCTTTTTGTATTTTTGAGCAGTCCTCAAATATTG
AACTCATTCGATGATGCAATACAATTAATGAGAATCAGTATTTCCATTTTAAAACAGAAA
TATGAAAGGCACTATCAAGAAAAATTTGCTACAGCATATTACACAATAGTTTACAATTTA
TATGATTACCTCATCAACCAAGAAAGTGATTTAAAAGATAAAAATCAGATAAATGAGAGT
GAAGAAATGAATTAATTCAAATCTTAAGTTAAGTCATGTATCCTATGTGGTTTGACTAGT
CAACATAATACAATCAGGTTTAATTCTTCAATTTTTTAATATAAAATTTAAATAAACATA
AAAAATAGAGAAAATACTTTCAAGTTCTTAGACAGGGAAACAAATGACTCAAAAACGCCT
TATGAAAGGCTTTTATACTTGATTTAGGAAATCTACTAGCCTGAATAAGAAAGGCTATGG
TTATTGAGTGCTGTCCCACTTATTATGTGTCTATCAAAGAGGACTTCAGACTATGACAAA
AATCTTTTTGATGAGTAACTTAGTAAGTTAGCATAGTTCTATGATTGGGATTTCAGAGAT
TCTCATAACATGAGACTTTACAATTCAAGTCAGCCATTGACTCCTCTTTACACCCTCTCT
CAAGTTAATTATAAAGACTCATAAGGATTTGCAATACCAGCTCCTCGTCGTATGTACAAT
ATCACAGGAGTTAGTTAGATGCCTATATGTAAAATCATTATTATTTTTCTTTAAAAATAT
TAAAATTTAATTTAAAAAAAAATAAAACAAAAATTAATTACTTAATTAAAAATTTTAATA
GATTTTTTTATAAATTTATTATAAAAATATCACATTAAATATTCATTTTTAATAATATTA
TTTTAATTTACTTATAAAATTAAAAGAAGAAGGAGTTAGAGCGACTGTTTATAGTTAATC
CTAAGATAACAGTTAAGGTGAAATGGTTATTCCTTCCTAAGATCAAGCAAGCTAAATGAA
CCAACTGGAAGAAAAGAGATAAATTTACCAAGATTAAATGAAAAGACTGGTCAATCCTTC
TCAATAGATTTCTTCATCGTTTTCATCTTCAAACAGAAACCCTTACACATTTAATTAAAG
TTAGCTCTTTTTTGATAATAAAATGAGTAGCATCTCTGAAGAAAATGAAGATGATGAAAA
CGAAGAAGGAGAAGAAAAGAAAATTGATTTATTTGGAACTGATATACAAAGAGAAAAGAA
GAATAACAATCTCAGCAAGTTCTTTGCATCTCACTTATTCGATTTTAGCTAAGTCAATAA
AAACTCAACAAACAAAATTAGGTAATTTTAAACAAAGAAAACTAGTTTTACTTAAATGAA
TAAATAAAATATATTTAGATATCAGGACTCAAAAGAAGGAAAAACATTAACTAATACTGT
TGACATAAAGAAGAGATAGCAACAGTTATTTTTTGAAAATCAAAATAGAATGAGAAAACA
ATAATTACAGACAATCAGAAAATATAAAATTGGTGAATTACCTGATATTGGTATCCTTTA
CAAGGTATTATTATAAAAATTTACATTTTATTTAATTCATTTTATATATTTTAACGTCTT
ATTTTTATTTAACATATGCCTTACTTACCCTTTAAAAAAGCTTAAATAATATACACAAAT
TTTAATTAAATACTTTATTTAAATTTAAAAAATTTTAACTATAATTCAATTTAGGATATT
ATTGATCCTCTGATGGCTTTGAGTTTCATCGATGAAACCTTAGCTGGATAATTATTCTAA
TTACTATTACATTCTATGTTTATGAAAGAAGAGTCTGCTGATAGATAACAAAAGCTAAAA
GATATTTTATCTAACATTTTAGCTAAGTCAATTGTTCATGATTTCAATTTCGTTTCAACT
ATTCATAAAACTATGATTATGCTAACTAAAGAAGGTGAGTTGTTTGATAGTAATATAATT
AAATAAAGTGGGTTGCTTAGTCATAGCTATTACACATCTATCCTGCTACTGGAAGAAAGT
CTTTTCTCGTTATTCCATAGGATAGATTAAAATGAATAGGCTGGTGATAAAGATGTTCTG
AAGAAAAGAAAAGAAATTCTTAAAAATAACTAGAAGAAAGCTTCCAGGGCTAGAGGAAGA
AAGGAAATGCAAATAGGTGAAGATGATTATGAAAAAGATTTAGATGAAAATGAAGAAGAT
CTTGAAGAAGAAAGACTCTTATATGAATCTAGAAAAAAATAATCTGAGAAGAAAAGATTA
GAAGTGAATTATTGGATGGATTTAATTGACATCTATTCTCATCTAAATGAAAAAGATCAA
ATCAAAGGCATTCTTAAAAAAACAGTTTCACACGAGGGATAAAAAGATATGATTGTTGCA
CTCGATTTGAAGTTCTCAGGCTAAATATAAAATTCTTTAAAAATATTGAAAGAAATTAGC
TCTAAAAATAAAGAAAGTGAAAGATAAAATTAATTTAGAATGGCAATAGAAGATAATTTG
AATAATTAGGTTAGTTTAGATGATAGAATTCAAGAGTATATTTAAAGTGAATATCAAGAC
ACACTTGCATTAATGGGTAAATAATTTTTTTTAATTAAAATTAAAAATAATTTGTTATTA
GGAAAATGGGATGATCTTGCAAATGAACTAATTGAAATCAATAAAGATGTAAAAATTTAT
CTTTGCAATTTATAAATTATTTTTTTGAAAATTAATAAATTTTTATATTAAAATTATCAA
TTTCTAAAACAAAATTCTTAAATTTAATATTAAAATTAATGATTTTATTTCTGAATATTT
TTAATTTGATGAATATAAAATTTTTATTTATTCTACATATTTTTTGTAATTGTTTTAGGT
TCTTGAATAACCAGAAAAAATAGGAGTAGAGAAAATGAAAATACTTATGCTTTCTCTTAT
GTAATCTGACTCAGCTGACACAAGTAGGTGGGAAGAGTTGAAAGATTATGTAAAGCTTTG
GATGAATACAGAATATGGTAAAAGCGTTTTAGAAGGTCCTCTTAGCTATGAAATGGCTCT
AATAACAATTTTAGATGGTGATATTGATAGGACGAGATATTATCATAAATTGAGTTAAAA
TCAATTCCTGAGGGTTTGGAGTAACTTTGGTAGCTTTGCTACAGCATCTAAGCATGAATA
TCTCTCTAATATTTATAAGAACTACGAACTTAAGGAATATCTCCATCTTGATGGCAAAAT
AGAAGCAACTTATGAAGACTTTAATAGCTTATTCAAAAACTGGTAGAATAGAAAAGTAAA
TATTTTTTTGTTTAAAGAGAAATATAATTAATTCTCACTTATAATCATTAAATTAGTTAG
CTTAAATTTTCTTTTACTTAACTTTAAATAAAAATATTTTTAAAATCAATCTATTTATTT
TACTTTTTGATGTTGCTTATAACAAATAGCCTTCTAACACATACGATAATTAAATTTGCT
GGGACTAGATACTAAATAGCAGAGAGATATTTGCTTTAGCTCTCTACTAAAAGTATAATT
TGGAAGATTAGTTTGTAAATAAAATAAGGTCTAATTGGTATATTCAAAATGTCAAAGGTA
TGCTTAAGAAAGGAATACACGGAGCTGCTGATAGAAAAATGAAAAAAGCAGCTGGCTATA
GAAAAGTTATGAATGGGTTACCTGAATTTAATTGGGACTACTACAAAATCACTTCAAAAT
TGAAACTTAAATAATTGGAAGTAGATTTAAAAAATGATTAAATCCCTGAGAACCCCTTTG
AGAAATTCAGCAAACTGATAAAAATTTTCGAGTAAGAGAAGGAGAAGTATATTCATTAAC
TAGACTAATCTCAAATAGTTAAATTCGAACAGCTTAATATTTAAGTGAACGAAAAATTCA
TTGATGTTTATTAAGATTATACCCTCACTCAAATAGTATTAAAATTTTTCATTTATAAGT
TTAGTTTTTTATGTTAAATATTAAATTTAATAGGTTGAAGACATTTTCTTAGAAAAATAT
GCAGATGTGATTAATAATATTTACTGGGGATATAATAAACTATTTTAGAATGATATAATG
AAAAAAGATATAGACTTATCTAGCTAGAGCTAATCGCTTAGTTAACCTTTTGAAAATACT
TTTTCTTTTAAAGGACCAGCTTCTCTTCCATAGATGGCTGGAAATAATAATTTCAACAGC
AGTGAATAAATTTTTGAAGAGATCATTCCAATGAGGTTAAAGAGTTACAAAAGATTTGCT
AATTTTTGTGAATAACTTTTAAGAATCATTGAGTCTGAGAGCAGAGATCACTTAAAAAAG
ACTTTGAAAGTTTAATATTAGGTAAATAAGTTAAATTACTTTAATGTTTTTTTAATTTTG
ACTAAATAAATAAATAGCTAACTGTTGAGACTGTTGGCAGTTCTTTCTTGGAATACACTC
TCAAGTGCTTTTCTTTAATGGGAGGAATTAACTAATTTGAACAAAAGTCAAATAAAATGT
AAATGGAAGTAGAAACAGGAGAAAAAATATAAGAAAATCCTGAAAAGAGCTAAAATCAGT
CAATTGAATTTGATTAGAATATGTCAAATTTAGTGCTAAAAATGTTAAGAATTATTTAAC
AAATCCCGAATATGACAGGCTAAAAGTTTAAGGAGGCCATAGAATTACAAATTATTCCTT
CATGGATATTTATTAGCTTCTTGCCTTAAATGATGCACATTTTAAAGAAATAGAATTTAG
TTGAATTTTTCGAACCTTTGATTAAAAAGCTTGCCAAAAACTATCCTGAGGCATTAATTT
ACTAGTTTAATACTATATTTAGCAACTAAACAACGTGCGAAACGGCTTTATCTTAAGAAA
TATATGAAGCATTACACAAGGAAATGCCTCATTATTATAATTTTATGTACCATTTGAATC
AAATAACTCACCCTGAGCATCGTTTGATTTACTACCTTGAATACCTAAAGAGCTAATTTT
TATCATTTTAGAAAATTCACAACACCTATAGCTCCTAAAAAGATTATGTTAAACTTAACA
AGGCTGTTGAAGAATATCAGAAAATTATTGATAGAATTTTAAAAGAAACAGAAGAGGATT
TGTTCTAACATAATATTAATGCAGATCATATGGGAAGTTATAACATCAAATTTTCAAAGG
ATCATATTAGCGAATTCAAAAAGCTTGTTAAGAAATTTACCGACATAACAAAGGGAGATG
ACTAAGATAAAAAAGAAGCCTATGATTTCATCAAAAAATTCAGAGATAAAGTCAACACAA
AAGATCTCAAATCAGGCTATGACAAACTTTCTAATTTTTCAAGTTTCCTATAAAACTTCT
AAGGTAATCCAGACAATTAGAATATTTCATTAAATAAAATATAACATAATTTGAAAAATT
TATTTCTTTTCATATTTTTATTTTATTAACAAAAATTAATATATTAGCTGATCACATTAT
TGAAATTCCTGGGTAATACACTTCTGGAGCAGTTATTACTGAGCCATACAAAGAGTCACA
CATTAAAATATAAAGTTTTGATTCATAAATTCTGACTCTCCAATCAATTCGTCGTCCCAA
AAGACTCTGTATATATGGCTCTGATGAAAAATGCTATAAAGTAAGCTATACATATATTTA
CTTAAAATAAACATATTATTCATTTAAAAATTTTTTTTAAAATAAAGTTTTTAGTAAAGG
GGATTGAAGATTTAAGACTAGATCAGAGAATAGAGCAACTGTTTTAAGTTATGAATAATA
TTTTCGAATATGATCCTTAATGTCAGTCTAAAGAGCTGAACCTTTCAACTTTCAACATTA
TTCCGATGACGAACATCTTAGGTTTACTTGAATGGGTTGATAAGACAAGCGTTTTAAAGG
AAATATTAAACAAAGAATTTTAAGAAAAAATGGGAAGCAAAGAAGACATTGCTTAAGACA
ATGAAGGGTTGAGAATGAGAAGAGAATGGCTTAAGCAACTAGACAGAAAAGGAGGTTTGG
CTGAACAGCATATAAAACTATAATTAGAACCATCAGGTAATATAGAATAAAAATAAGTAA
TAATTAAATGTTGTTAATATAATAAAAATTAGACAAAATCGAATAAGCATTCAATGAATA
GGCTGATTTGATTCCAAGGGATGTGTTTAGGAATGCGCTTGAAAGACTAGCTTCTACTTG
TGAAACCTATTTGTACTTAAAAGAAAGATTTATAAGAAATTATGCTGTTGTTTGTGTTTC
AGGATATATTCTTGGTATTGGTGATAGACATTTAGAAAATTTCTTAGTAAATTACTCTAA
CGGTGATATAGTTTCAATTGATTTTGGTTACAGTTTTGGTGCTGGTCTAGGACTTGCTGT
CCCAGAGCTAATGCCATTTAGATTGACAAGGTGCTTTACAAATTTAATGAGTCCTATTGG
AATTAATGGAATCTTTAGATAATCAATGATCTCATCAATGATGGCTTTAAAAAAGAAAAG
AAACATCTTACTTGAATTCTGTGAAGTATTCATAAACGATCCTTTGGTTGATTGGGTTAA
GCTTACAAAAGACAAAAAAATGGGTAATTGAATGTCATCAAGATATATTTAAACATTTAA
TATTTATATTCAAAACAGGCACAATTATGTTTAGTGAGAATATTGGGCATTTAGATTCCA
CCAAGACTTATAACGCAGAGCAGTCATAATCATAATAACAGTATGGATTAAGTACTATGG
AGGCTAGTCAAATTGCTGATCTAATGATTCATATGTAAAGAATTGATATTGTAAAGCTAA
AATTAATTGGAATGAATCCTTCTCATTTATTTACTGAAGAGTTATCTTCAACAAGACATA
AAACTGGAAACTACTTTTAGCATTTAAAGTCTGCTTTAAAGGGAAAACCAAAATCGATTA
GAAATCAATATAACGAAAAACAATTTTTAGAAGTACATGAACAAGTAGATTGTTTGATAG
ATTTGGCTGTTGACCCAAATATTATAGGAAGAGTTTGGATTGGATGGGCACCAATCATAT
GA