Identifiers and Description

Gene Model Identifier

TTHERM_00048980

Standard Name

DPB2 (DNA Polymerase B subunit 2)

Aliases

PreTt11277 | 3.m01906 | 3824.m03035

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00048980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01657.19.997093137033517e-262hypothetical protein (646 aa)
OxytrichaContig13216.0.g1007.002785992501305e-33DNA polymerase alpha/epsilon s
ubunit B
DictyBaseDDB_G02783674.9976494746363024e-29DDB_G0278367 on chromosome: 3
position 766301 to 768775
WormBaseWBGene000172371.0004572433669413e-23locus:pole-2 Probable DNA po
lymerase epsilon subunit 2 s
tatus:Partially_confirmed Un
iProt:Q19196 protein_id:CCD6
7651.1
SGDYPR175W6.002144168983342e-19DPB2 Second largest subunit of
DNA polymerase II (DNA polyme
rase epsilon), required for no
rmal yeast chromosomal replica
tion; expression peaks at the
G1/S phase boundary; potential
Cdc28p substrate

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00048980(coding)
ATGGATAAGAGGTCATTAATAAAAAGGTTTACAGAAGAGGGATATACACTCCGTCCAGAA
TGCTTGAATCATTTAACAGAGTACTTCTCTTAACTTAAGATTTAGAATAATAATAAAATT
ACTCCAGATGTTGTAAAAACTCACATGAGTAAAATTTTAGAGAATGTTAAATCACTATAA
TCTCATCAAGGAGATATAATTTTAGGAGAACAAACAGTTAAAGGTGCAATTGAATTACTA
TAAAGACCTTAAAACTAAGTGATGGAGTTAGAAATAGATGTAGATAAAGAAAAATTAAGT
GAAGAAAATACAATTATTGATGATGACAGAGAGAAGAAAGTAAATGATATAATCAATGAA
AAGTATTTACATACAATAGTTGTTTTGGATACAATGAATGAAACTCCTAGAATAAGAATT
CATAACAATAAACCCTATACAGAATTTATAGTCAACGCTAATACACAAGAGGAGAAAAAA
TAAACAGTTTCATTGGGTGCACCCTCAGATAAAGTTAATGTTTTCATAAAAAGACTAGAG
ATAATTAAAACAAAACTTTCCTAAGGTAAAAAATACTACTTTGGAGCAGAAAACAAAAAG
AAAGTTGCTGGTACAAATGATCTTGAAGGTGAAGAATAACAATAATAGTCATAAGAATTA
AACGATATTGGTTCTTTAATTGGAAGTAAAGGAAAAGAAATGTGCTGCCTAGGTATGATT
TATGAAGGCGTTCCAGGAGATTATTATATGCAAGATGAGTTTAGTAGAGTGAAGATAAAT
TTAGAATAGGCATAAGTTGAGTTAGGCTATGTAACAGTCACAAGTATTGTTATTGCAAAA
GGTGTTTTTGATTAAATGTAGGGTGCTTTTGTAATTTCTAAATTGATGCTACCTGAATTC
GAAGAAGAAGTAAATTTGAATCCTTCTGTATTCAAGAAAGAAAGTTCTGATTTTTTTGGA
GCAAAAGCTAAGGTGCAAAGAATTTTAGGTAAATTAATCCAACTCGAAATAGAAAGTGCA
TCATTAGGAAAATAAGGTAGCAGAGCCTAAAATTTAACTAGATTTTAAAAAGAAAGACAG
CTTGAAATGGGAATATTTGACTTAGATTTAAACCCTTACTTTTAAGTTTCAGAAAAAAAT
GAATATTGTGTTTGTGTGTTCAGCGATTTCTTAATCAGTGATAGAAATACTCTTAAAAAG
TTTGAGGGTATTCTTTAAGTTTACGAAAGCTAGTTAAAACCCTTAGTTATTATATTAATG
GGAGCCTTCTTTAATGTATCAGAAATTAACTCAGAATTTGTAAATGATTAAGTCAAAGAA
GCAATAAACGATTTCTTGAACTTATTAAATAAATTCAAGTCGCTAAGAGACAATTGCTAT
TGGATAATGGTCCCTCATATAAATGATATTGGAGGAATGCCAGTTTAACCTAAGAGCGAA
TTACCTGAACATCTTTTCACAGAAATAAAGTCTATTATCCCTTTCTTTAAATTAGTATAA
AATCCTTGTCGTTTATCAATTTTAGGTAAAACCTTCTTGATTTAGAGAAATGATTTAATC
AAAGATTTACGTAAAAGGTAAATTGTGATCAATCATCATAAAGATATTTAACTAAATTAC
GCTTAAACTATTCTATCTTAAAGACATTTATCTCCTCTTCCACTTATAATAAAACCAATA
ATTTGGAATTATGATAATACTTTGTTATTTTATGATAATCCTGATTATTTAATCTTGGCT
GATTCTTATAGTGATTAATTTGATTTTATTATGTAAGAAAAAGTGTTGACAAAGGAAGAA
TAAAAATCAAATATTTAAAAAACATATGTACTTAATCCAGGTAGTTTTGAGAAAAAATCT
ACTTTCACAGTTTTGTACCCATTAGAGGGGAGAATTGAAACTTGCTCTGTTTGA


>TTHERM_00048980(protein)
MDKRSLIKRFTEEGYTLRPECLNHLTEYFSQLKIQNNNKITPDVVKTHMSKILENVKSLQ
SHQGDIILGEQTVKGAIELLQRPQNQVMELEIDVDKEKLSEENTIIDDDREKKVNDIINE
KYLHTIVVLDTMNETPRIRIHNNKPYTEFIVNANTQEEKKQTVSLGAPSDKVNVFIKRLE
IIKTKLSQGKKYYFGAENKKKVAGTNDLEGEEQQQQSQELNDIGSLIGSKGKEMCCLGMI
YEGVPGDYYMQDEFSRVKINLEQAQVELGYVTVTSIVIAKGVFDQMQGAFVISKLMLPEF
EEEVNLNPSVFKKESSDFFGAKAKVQRILGKLIQLEIESASLGKQGSRAQNLTRFQKERQ
LEMGIFDLDLNPYFQVSEKNEYCVCVFSDFLISDRNTLKKFEGILQVYESQLKPLVIILM
GAFFNVSEINSEFVNDQVKEAINDFLNLLNKFKSLRDNCYWIMVPHINDIGGMPVQPKSE
LPEHLFTEIKSIIPFFKLVQNPCRLSILGKTFLIQRNDLIKDLRKRQIVINHHKDIQLNY
AQTILSQRHLSPLPLIIKPIIWNYDNTLLFYDNPDYLILADSYSDQFDFIMQEKVLTKEE
QKSNIQKTYVLNPGSFEKKSTFTVLYPLEGRIETCSV


>TTHERM_00048980(gene)
ATGGATAAGAGGTCATTAATAAAAAGGTTTACAGAAGAGGGATATACACTCCGTCCAGAA
TGCTTGAATCATTTAACAGAGTACTTCTCTTAACTTAAGATTTAGAATAATAATAAAATT
ACTCCAGATGTTGTAAAAACTCACATGAGTAAAATTTTAGAGAATGTTAAATCACTATAA
TCTCATCAAGGAGATATAATTTTAGGAGAACAAACAGTTAAAGGTGCAATTGAATTACTA
TAAAGACCTTAAAACTAAGTGATGGAGTTAGAAATAGATGTAGATAAAGAAAAATTAAGT
GAAGAAAATACAATTATTGATGATGACAGAGAGAAGAAAGTAAATGATATAATCAATGAA
AAGTATTTACATACAATAGTTGTTTTGGATACAATGAATGAAACTCCTAGAATAAGAATT
CATAACAATAAACCCTATACAGAATTTATAGTCAACGCTAATACACAAGAGGAGAAAAAA
TAAACAGTTTCATTGGGTGCACCCTCAGATAAAGTTAATGTTTTCATAAAAAGACTAGAG
ATAATTAAAACAAAACTTTCCTAAGGTAAAAAATACTACTTTGGAGCAGAAAACAAAAAG
AAAGTTGCTGGTACAAATGATCTTGAAGGTGAAGAATAACAATAATAGTCATAAGAATTA
AACGATATTGGTTCTTTAATTGGAAGTAAAGGAAAAGAAATGTGCTGCCTAGGTATGATT
TATGAAGGCGTTCCAGGAGATTATTATATGCAAGATGAGTTTAGTAGAGTGAAGATAAAT
TTAGAATAGGCATAAGTTGAGTTAGGCTATGTAACAGTCACAAGTATTGTTATTGCAAAA
GGTGTTTTTGATTAAATGTAGGGTGCTTTTGTAATTTCTAAATTGATGCTACCTGAATTC
GAAGAAGAAGTAAATTTGAATCCTTCTGTATTCAAGAAAGAAAGTTCTGATTTTTTTGGA
GCAAAAGCTAAGGTGCAAAGAATTTTAGGTAAATTAATCCAACTCGAAATAGAAAGTGCA
TCATTAGGAAAATAAGGTAGCAGAGCCTAAAATTTAACTAGATTTTAAAAAGAAAGACAG
CTTGAAATGGGAATATTTGACTTAGATTTAAACCCTTACTTTTAAGTTTCAGAAAAAAAT
GAATATTGTGTTTGTGTGTTCAGCGATTTCTTAATCAGTGATAGAAATACTCTTAAAAAG
TTTGAGGGTATTCTTTAAGTTTACGAAAGCTAGTTAAAACCCTTAGTTATTATATTAATG
GGAGCCTTCTTTAATGTATCAGAAATTAACTCAGAATTTGTAAATGATTAAGTCAAAGAA
GCAATAAACGATTTCTTGAACTTATTAAATAAATTCAAGTCGCTAAGAGACAATTGCTAT
TGGATAATGGTCCCTCATATAAATGATATTGGAGGAATGCCAGTTTAACCTAAGAGCGAA
TTACCTGAACATCTTTTCACAGAAATAAAGTCTATTATCCCTTTCTTTAAATTAGTATAA
AATCCTTGTCGTTTATCAATTTTAGGTAAAACCTTCTTGATTTAGAGAAATGATTTAATC
AAAGATTTACGTAAAAGGTAAATTGTGATCAATCATCATAAAGATATTTAACTAAATTAC
GCTTAAACTATTCTATCTTAAAGACATTTATCTCCTCTTCCACTTATAATAAAACCAATA
ATTTGGAATTATGATAATACTTTGTTATTTTATGATAATCCTGATTATTTAATCTTGGCT
GATTCTTATAGTGATTAATTTGATTTTATTATGTAAGAAAAAGTGTTGACAAAGGAAGAA
TAAAAATCAAATATTTAAAAAACATATGTACTTAATCCAGGTAGTTTTGAGAAAAAATCT
ACTTTCACAGTTTTGTACCCATTAGAGGGGAGAATTGAAACTTGCTCTGTTTGA