Identifiers and Description

Gene Model Identifier

TTHERM_00758980

Standard Name

DOP1 (DOPey domain-containing protein 1)

Aliases

PreTt08195 | 124.m00113 | 3821.m00528

Description

Dopey domain-containing protein; interrupted by TPB1-dependent IES; failure to excise internal eliminated sequence from DOP1 results in large vacuole phenotype

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00758980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20878.19.997093137033517e-262hypothetical protein (2160 aa)
OxytrichaContig10767.0.g783.999582750711782e-108Dopey, N-terminal
DictyBaseDDB_G02931281.9993007828132465e-27DDB_G0293128 on chromosome: 6
position 2567187 to 2574265
WormBaseWBGene000039051.9991095569230066e-20locus:pad-1 Protein pad-1
status:Confirmed UniProt:Q9X
W10 protein_id:CAA22324.2
Stentor CoeruleusSteCoe_271330.00000000027894680928689246
SGDYDR141C0.0000000039998859049333245DOP1 Golgi-localized, leucine-
zipper domain containing prote
in; involved in endosome to Go
lgi transport, organization of
the ER, establishing cell pol
arity, and morphogenesis; dete
cted in highly purified mitoch
ondria in high-throughput stud
ies

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28087716: Cheng CY, Young JM, Lin CG, Chao JL, Malik HS, Yao MC (2016) The piggyBac transposon-derived genes TPB1 and TPB6 mediate essential transposon-like excision during the developmental rearrangement of key genes in Tetrahymena thermophila. Genes & development 30(24):2724-2736

Sequences

>TTHERM_00758980(coding)
ATGGATAAAACAAAACAAATCGAAAAGTCATCCCAGCTGAATAAGCAGCTCAATACACTT
CTTAGTGGATTCGAAAAAAATAAGGCATGGTCAGATATTGGTACTTGGCTCTATAAGGTT
GAGCAAGCTATGAAGGAAAACCCAAGTCCTTATATAAGCGAAAAGCTTTCTTTGGCAAAG
AGATTAGCACAGTGTCTTAATCCAGTCTTGCCATAAGCTATTAATTTGCAGACACTTAAA
ATTTATGAGCTTATCTTCGAAAATATAAAAATAGCTTCCCAAGGCAATGTAGAAGAATAC
AAGAAGATGTTCTGTGAAGACATTGGTATTTACAGTGTTGGTCTCTTCCCCTTCTTTTAG
AATGCTCATTAAAAGAATAAACATCAATTCTTAGAAATTATTCGTAATTATTACATACCT
GTAGGAAGAGATTTGATACCATGTCTTCCTGGTCTTGTGCTATCTATACTTCCTGGTTTA
GAAGAGTAGAGCGAAATTTTAATTAAAGATGTTACCAAAACTTTAGAAGCCATCATGACT
TCCTGTGGTAGAAGATACTTTTTAGGTAGTGTCTGGATGGGTATCAAGAGAACTCAAAGA
GGAAGAGAACACGCAATTAAGTTTTTGACCAAGCTCCTTCCCAAAGTTAAATATGAAGAA
GATGAAGAAGAAAATTAAGATGCAAGCGATAATTCTTCAAATTTTTCAGAGGATAATTAT
GAAGAATTTGATGAGACTAAGTTTAAAGAGCAACAGAAAAAAGAATAGACATAAACTGTG
GAATAGACTCCTGTCAAGCAAAACTAATCGCCTAAATTTTAAGAGCAACAAGCAGAGTAA
GCAGATCAAGTAGATCATGATTAATAAAATAATTAGGTAGAAATTCAAGATGAAGAAAAA
ATCGCATAAGACTTGATTTAATAAGCTTAAGCTGAAGCAGAAAAGCACTTTTAAAGTATG
TTAGAAGGAAATGAAGAAAACTAGGATTAGCAAGAATAGCATCAAGAAGAATAGTAGCCA
TAATAACCAGTAGAAGAATAAGAAGTAGAAGATGATTAGTAATAAAAGTAACTTAACAGG
CAATAAGCTGATGAAGAAATCCAAAAGAGCTTAGTTGCTTCATTATAATAATAGCAATAA
TTATAATAATAATAGCAATAATTATAATAATAATAATAATAATAATAGCAGTAGTAACAA
TAATAGCAATAGCAATAGGCAGCTACATCTACAAGCACTGCCCCTGTTAGTGCAGCTAAA
TCACTTACTGATCAAAAACTAAATATTTTAGAATCTACATCAGAATAAAAAAAGGGTGGT
AAGAGCGCTTTGGAAATAGCATTTTAACATGAAATCGCTCCTAAGATAGCTAAAAAATAA
GATTTCACTAATACTTTCTTTGTGCGTGACAATTTGAAATACATTGAGGAAAGCATAAAT
GAAAATGATGACAACAATAATTTCCCTAACAAAAGCTCTTTAATTATTAACACAATTTTA
TCTTGTTTTGAAGACGAAAATTAAATTGTAAGAAGAAATATTCTTGATTTAATGTATCAC
CACTTAAGGATAAATCATAGAATACTCTCTAGAGATGATTAACTAATTTTAGTTGAAGGT
GTGCTTTATTTGTTAATTAGAAAAGATGTTTCAGTTACAAGAAGAGTCAATGTTTGGCTT
TTTGGAAAACCAGATATGGACAACAAGTACACAATAACTAAAAGCAGAGAATTTGTAGTT
GATTTGTTGATTGATGCTTTCAAGAGAATTTTCAGTGTAGAGCCTTAAGATAAGGTAGCT
GCTTTATAGCCAATTAAAATTATGCAATAGTTCTACATGGAACATGAAAATTTAGTAGAA
ATTACTCTTAGCAAATTAGCTATCTCATTTGTCAAATATGTTTACACTCACACATAGAAT
ATGCAATTTTCAGCTGATGTCTTAAAGAGTGGTATTAGATTTATGGAAAATATCTAAGGA
CAGCTTAATTCTTTATTGAAGAGTATCTCAGAAGAAGCAGTTTAACTTTTAAGAGAGAAG
AAAGATGATTAATGCTTGGAAATTATTAATCTTATTGAGTTTACCTATGAAAATCTTCTT
GCTTCTGAAGATTCCTTTGATCCTATGTAATAAAGAGATTGTATTAAGGAAACTTTGTCA
AGATTATTTATCTCTTTAAGCTATCTTGATGAAAAAAATATCCAAGAATTCCATTCACTT
GAACCAACTTTGAAGGTTATTTACAAGCTTATGCTTAAATTAGAAAGTGCTGAAGCAAAA
ATTAAAGCAATCGAGAAAAAAGAAAAGAAATAATTAGAAATTACAAATGAATAAAAAGAA
ATAGCATAATATCTTGATGAATGCTCTGAAAAATACTTTAATTTCTATGGTAAACTCAGT
AACGAGTTAGAAAATTTCAAGTCAAATAATATCTACAAATTAGCTTCTCAGAGCTTAGTT
AAGCTCTAAAAGTTCTTGTTCGACAAAAAGAAAATGACTCAGCTTCCTTAATGGTTTAAA
TGCATCTCTCAATCCATTAAAATTACTAATCCTAATCTTTCTCTTATTGCCATTGAGTCC
ATGATTGAAATTATGATTTCCGAAAAAATTGATCCCATCTATGAGTAATTGAAAGTCCTA
ATTATTGATGAAGCCAAGCTAAAATACTCTAAGAAAAACGAACTTGTAGCTGGTAATGAT
TACACTAAATTGACTCTAGAAAAGCTCTGGAGTTTACTAGATTTCTAGCATTTCTACGAT
AGAATCATCGATTTAATTATCTATTTCTCCAAATATTTCCCACAATACTTTAAAGAAGTT
GTAGTCAATAGTTTCCAAGCTGTCTCTATTACTGAAAAAGAAGCTTCAATTAGAAGATTT
GCTGTTTTCTGGAGATTAACAGCCCACCACAAATCAAAATTACTCCTTTCTGAGTTAAAT
AAAGTTGGTCTTTTTATTATGTTAGACTTTTTAGATCATGATAATCCTTTAATTAGACAT
GCTTCTAAGAATTGGTTGATGGAGAGTGTCCCTCAATTTTACAGAATTATTGATCCTTTG
TTTGAGGTGCTTCTGTAAGCTAATAGCAGCTGGTATGTTACTGATAGCTACTAAGTTTTT
TATACTAAAATTTACGAGACCACTCGTGCTAATGAAACTTTCAGAAAATTAAAGAGCATT
CTAATTATTGCTAGTGACGTTTTCTTAAAGTACATTTCTTCTTATCAGTTGAGCCCACTT
CTTTAGGATATGAAGTCCCACTTTACTGATAAAAATCAAGCCGTTTTACTTAGAAAGCTT
GGAGCTACTATGAGCTATTTCAGTACAATTAATCCTAATTTGAATTCTTTAGATATGACT
AGTTCACAATCTACAGCTGTAAACGATAAAAAGGTTACTGACTTAAAGATGACTTACTTA
GATTTGTTGATAATTGTTTGCCTTCGTTATATTTAAGGATAAGCTTTGGAAAGTTTGTCA
TTGAAATTCTAAGTTGAAAATGCTGCTGTTAATGCTTCTGCATGTGAATATATGGAATTA
TTAATTACTCATCTTGAAGATGCTCCATTATGTTTGGCTCTTTGTGAGTATCTCATGGAG
CCTCTTTTGACTATTTTAGGTCACTGCATTACAAACAGAGACTACGTCATGCAAGTACAA
TTACTGAATGTTTTTAGAATAATATTCTTCCATTCTTCGTACATAAAGAAGAATAATACT
GAAGAAATCAAATTTAAACTTGTTTAAACTCTTTCAAATAAATTATTTATTCCTAACATT
TTGAAAGGTTTAATGACTTCTATCCCTTACGTTAGATCTTAATTTATTTCATTTATCAGC
GCTTGTATTCCACTCTTGAGTACATATTTAGCCTCTAACCAACTAACCAGTATTATAAAG
TCAATTATGTTTACCTACTTTTCTTTGATCAAGCACTTGGCTACTACTCCTGCTCAAGAT
AACGATGAATCTATGGTCACTATAAGCAAAACTTAAATTATTAAACAGCCTTCATTGATT
AAACAAAATAAAACCGTTATTCTCATCCAAACTTAGGAGGTAGTTAAGGAAGACTCTAAT
ATTTATGAGATACACACAGTTTTAGAAGGTGTCAGAACTATTCTCTAATTCTTCCTTAAA
ATTAGAACTCTTGAAGAAATTGAATCTAGTAAAAAAGATCAAAGCGGTGGATTTGCTAAC
CTCATGAAAACTGTACTCACACTTGGTTTAGCTGGAAGTGGAAATGCTAATGACAAAGAC
AAAGATGGCAAAGCATTCTTTGAGAAATATCCTGATACTTGTAAGAGTTTGCTATATGAT
ATCAAGTAAGTCGTTGAATTGTTTATTAACAGTTGGCAAACAACTCCAGAATTTATTACT
GAATTCACAAGTTATGGTATCAGACCTTATGAACAAAAGAAATTCAACTCATTTAATAAT
TTATTGATGGACATGATCAAAAATGCTGAGAATGATAAACAGAGAGTTAAAATTTTAATT
ATTTCTATTATCAAACCTTTGGTATATGAATTCCCTAACGATATGATGAATTCCTTTTTA
CTTTTATGGAACCGTAGCTGCATGACTGACCCACCAAATGCCCACAAGGATTTCAACTAA
AACGAATTCTTAAAGAAAATGATAGAAATGATAACTATTTTAAATATTCCCAATGAACTT
TTCTTAGAATCATTCTATCAAAGCTTTATCAGTGAAATCATTCAAAAATTCTACCAACAA
AAGAACACTAAAGAAAAGAAAAATGTTTACTTCTTAAACTATGAAATTGCTCAACACGAG
TCTAAGCTCCTTTACTTCCTTTACATATATCTTTCATATACTTACATTGACAGCAATATT
CTTAAAAAAGAAAACCTTCTACTATTCTGGAACATTATCCTTAAAATCTTAAAAATATTC
TAACCCTCTAAAAATCCTAACACTGTGATGTGGATGCTTGATCTTTTGTACATGTTGAGT
GAAAAGTACTCTCCAAAGGAAATTTTATCAGATAGTAAGTTCAAGAAGGAATTGCACGAT
TTGATAAATGAAAAGCTTTCTTACTTGTCTGGCTGGATTGCTAACGTTTACTAAGTCAAA
TTTAACGAACCTTCTGCTTAAACTTAATAGTCTTTGAATAATGCAGTTGATTAACACATG
AAGGAAATGATTGTACAGAGCTTACAATAATATAGAATAATATCTCCTTACTCTCCTACT
TTTTACGAAATTAGTTTATCATTTTACAGTCAAATACACATTTTAGAGCATGCCCCTAAA
AGTATTGCTAACTAGATGAAGGAATTGTAGATGAATTAATTGGATCAATTCATCTTTGAT
CGCATTGATACTGTTGACGAAAATGCTGTTTATGATAAATACAGATTAATTTGTTTGGAA
ACCCTCAAAACATTGTCTCTTGAGTTACTCTAAAATACTTACTCTCCAGAAAGATAGGAC
AGAGTTGTCGTTCGTGTTAAGGAGTTTGTTGATCCCTTATATGCTGTTATTGAAAACAAA
GGAAGCACAAATTCTTACTTCCTTGAAAGTACTTCAGAGCTCATTTGTAGCTTGATCGAG
AAAGCTCCTTCTCTCTTGATTAAAGATTTCAGAAAAAGTATCTTAGAAATGTTTAACAAA
GATAACTTCTTCTCTTGCAATAAGGGTACTTTGCGTTACTGGGGAAAAATTATAGATTAT
GTTCTTACTCAAGATAAATCTAATGACCTTTTCAATGAATATCTTGAAAAAGTAAGTCTT
TCTGCTGGTTTCTTTGCTCGTGAATAGAATGAAAACAAAAAGAAAATAAAGGCTTTCAAA
AGAACTTGCTTTATCATCTTTTCAGGTGCCAAGGACAAATATGCCAATCGTTTACGTAAA
CTTTTAGACAGTATCGCAGAAGTCATTAAAACAACTGATAGCTCTTAATCTTCTTTGCTT
ATATTAATTCTTTTCTGCATTCGTATATTGATTCTTCGTCTATCTCAAAGCAACTTAAAT
GAACTCTTCAGACAAATCTGGCCCATTTTGCTTACATTGTTGATTCAAATATATTCAAAA
CCACTTCCTGGTCAACCTCCCCGTAATCCTAACTTGATGCTTGCTGGTTTGAAATTAATT
GAAATTCTCTCAGTTGCTCAACTAGATGAGTTCTTCTTGCATCAATGGATGTTTATTTTT
GATTATTTCGGTCTTAAATTATAACCTTTGTCCTAATAAGAGCGTGAAAACCAAATCAGA
TTAAGAGGCTAAATGAATGAAGCATAGCTAAGATAATATGCGAAAATATCTCCTTTCTAC
TTCTAGCCTTTCGTTTCTACTTGTCTTAATGAGTAGGATTTAGGAGTTAAGTATGTAAAT
CAACCAATAGATGAATCAGAATAATCAGAATAAATTACATATCAAAAGAAACAACGTAAA
TTAATTATGACTTAATGTAAAGTAGATGATGAAAATGAACTAAAGAGCCATGCTTTATCT
CTCTGTCAATATTTAATTTCAAATAACGAAAACCGTACAGAAATAGACTTTAACTCAATC
GAAGCCTTGATAGAGGATGACTTCATCAATTTAGATGAACACATTTTGAAGGTTTGA


>TTHERM_00758980(protein)
MDKTKQIEKSSQLNKQLNTLLSGFEKNKAWSDIGTWLYKVEQAMKENPSPYISEKLSLAK
RLAQCLNPVLPQAINLQTLKIYELIFENIKIASQGNVEEYKKMFCEDIGIYSVGLFPFFQ
NAHQKNKHQFLEIIRNYYIPVGRDLIPCLPGLVLSILPGLEEQSEILIKDVTKTLEAIMT
SCGRRYFLGSVWMGIKRTQRGREHAIKFLTKLLPKVKYEEDEEENQDASDNSSNFSEDNY
EEFDETKFKEQQKKEQTQTVEQTPVKQNQSPKFQEQQAEQADQVDHDQQNNQVEIQDEEK
IAQDLIQQAQAEAEKHFQSMLEGNEENQDQQEQHQEEQQPQQPVEEQEVEDDQQQKQLNR
QQADEEIQKSLVASLQQQQQLQQQQQQLQQQQQQQQQQQQQQQQQQAATSTSTAPVSAAK
SLTDQKLNILESTSEQKKGGKSALEIAFQHEIAPKIAKKQDFTNTFFVRDNLKYIEESIN
ENDDNNNFPNKSSLIINTILSCFEDENQIVRRNILDLMYHHLRINHRILSRDDQLILVEG
VLYLLIRKDVSVTRRVNVWLFGKPDMDNKYTITKSREFVVDLLIDAFKRIFSVEPQDKVA
ALQPIKIMQQFYMEHENLVEITLSKLAISFVKYVYTHTQNMQFSADVLKSGIRFMENIQG
QLNSLLKSISEEAVQLLREKKDDQCLEIINLIEFTYENLLASEDSFDPMQQRDCIKETLS
RLFISLSYLDEKNIQEFHSLEPTLKVIYKLMLKLESAEAKIKAIEKKEKKQLEITNEQKE
IAQYLDECSEKYFNFYGKLSNELENFKSNNIYKLASQSLVKLQKFLFDKKKMTQLPQWFK
CISQSIKITNPNLSLIAIESMIEIMISEKIDPIYEQLKVLIIDEAKLKYSKKNELVAGND
YTKLTLEKLWSLLDFQHFYDRIIDLIIYFSKYFPQYFKEVVVNSFQAVSITEKEASIRRF
AVFWRLTAHHKSKLLLSELNKVGLFIMLDFLDHDNPLIRHASKNWLMESVPQFYRIIDPL
FEVLLQANSSWYVTDSYQVFYTKIYETTRANETFRKLKSILIIASDVFLKYISSYQLSPL
LQDMKSHFTDKNQAVLLRKLGATMSYFSTINPNLNSLDMTSSQSTAVNDKKVTDLKMTYL
DLLIIVCLRYIQGQALESLSLKFQVENAAVNASACEYMELLITHLEDAPLCLALCEYLME
PLLTILGHCITNRDYVMQVQLLNVFRIIFFHSSYIKKNNTEEIKFKLVQTLSNKLFIPNI
LKGLMTSIPYVRSQFISFISACIPLLSTYLASNQLTSIIKSIMFTYFSLIKHLATTPAQD
NDESMVTISKTQIIKQPSLIKQNKTVILIQTQEVVKEDSNIYEIHTVLEGVRTILQFFLK
IRTLEEIESSKKDQSGGFANLMKTVLTLGLAGSGNANDKDKDGKAFFEKYPDTCKSLLYD
IKQVVELFINSWQTTPEFITEFTSYGIRPYEQKKFNSFNNLLMDMIKNAENDKQRVKILI
ISIIKPLVYEFPNDMMNSFLLLWNRSCMTDPPNAHKDFNQNEFLKKMIEMITILNIPNEL
FLESFYQSFISEIIQKFYQQKNTKEKKNVYFLNYEIAQHESKLLYFLYIYLSYTYIDSNI
LKKENLLLFWNIILKILKIFQPSKNPNTVMWMLDLLYMLSEKYSPKEILSDSKFKKELHD
LINEKLSYLSGWIANVYQVKFNEPSAQTQQSLNNAVDQHMKEMIVQSLQQYRIISPYSPT
FYEISLSFYSQIHILEHAPKSIANQMKELQMNQLDQFIFDRIDTVDENAVYDKYRLICLE
TLKTLSLELLQNTYSPERQDRVVVRVKEFVDPLYAVIENKGSTNSYFLESTSELICSLIE
KAPSLLIKDFRKSILEMFNKDNFFSCNKGTLRYWGKIIDYVLTQDKSNDLFNEYLEKVSL
SAGFFAREQNENKKKIKAFKRTCFIIFSGAKDKYANRLRKLLDSIAEVIKTTDSSQSSLL
ILILFCIRILILRLSQSNLNELFRQIWPILLTLLIQIYSKPLPGQPPRNPNLMLAGLKLI
EILSVAQLDEFFLHQWMFIFDYFGLKLQPLSQQERENQIRLRGQMNEAQLRQYAKISPFY
FQPFVSTCLNEQDLGVKYVNQPIDESEQSEQITYQKKQRKLIMTQCKVDDENELKSHALS
LCQYLISNNENRTEIDFNSIEALIEDDFINLDEHILKV


>TTHERM_00758980(gene)
ATGGATAAAACAAAACAAATCGAAAAGTCATCCCAGCTGAATAAGCAGCTCAATACACTT
CTTAGTGGATTCGAAAAAAATAAGGCATGGTCAGATATTGGTACTTGGCTCTATAAGGTT
GAGCAAGCTATGAAGGAAAACCCAAGTCCTTATATAAGCGAAAAGCTTTCTTTGGCAAAG
AGATTAGCACAGTGTCTTAATCCAGTCTTGCCATAAGCTATTAATTTGCAGACACTTAAA
ATTTATGAGCTTATCTTCGAAAATATAAAAATAGCTTCCCAAGGCAATGTAGAAGAATAC
AAGAAGATGTTCTGTGAAGACATTGGTATTTACAGTGTTGGTCTCTTCCCCTTCTTTTAG
AATGCTCATTAAAAGAATAAACATCAATTCTTAGAAATTATTCGTAATTATTACATACCT
GTAGGAAGAGATTTGATACCATGTCTTCCTGGTCTTGTGCTATCTATACTTCCTGGTTTA
GAAGAGTAGAGCGAAATTTTAATTAAAGATGTTACCAAAACTTTAGAAGCCATCATGACT
TCCTGTGGTAGAAGGTAAAAAATTTTCTACTTTTTTATCACTTAAAAGCAAAAAAATATA
AGCACGTTTTAAAACTAAAGCTATTTGTTCTTATAATGTGGCTCTTTTATTTTTATAAAA
ATAAATTAAATGCATTCAAAAATAATTTAAAAAAACATTTAAAAGTCGCCTTATAAATCA
TTTTAAGAATATCTGTATCCTATGTAGATTTTTATAATTTTCTTTTTTAAAGATACTTTT
TAGGTAGTGTCTGGATGGGTATCAAGAGAACTCAAAGAGGAAGAGAACACGCAATTAAGT
TTTTGACCAAGCTCCTTCCCAAAGTTAAATATGAAGAAGATGAAGAAGAAAATTAAGATG
CAAGCGATAATTCTTCAAATTTTTCAGAGGATAATTATGAAGAATTTGATGAGACTAAGT
TTAAAGAGCAAGTAAATAAAATTTTTTTGGATTTGGTATTTTATAAAAAAGAAAACAATT
TATTTTAAGCATTTTTGATCAAAATGCTGATAAAGCAATATAATAAAACAAAAATCTTAA
ATCATAGTTTTGATAATTAAATGAAATCATATTATTTTCAGTTATTTTTAATCAAAAATG
ATTGATCTATTTAATTTGGAATTTTAGTCAGCAAAGATATTATTTTTGTAAGATATTCGA
TGTATTTATTTATGATTTTTATTCAATTTAAAACAGCAGAAAAAAGAATAGACATAAACT
GTGGAATAGACTCCTGTCAAGCAAAACTAATCGCCTAAATTTTAAGAGCAACAAGCAGAG
TAAGCAGATCAAGTAGATCATGATTAATAAAATAATTAGGTAGAAATTCAAGATGAAGAA
AAAATCGCATAAGACTTGATTTAATAAGCTTAAGCTGAAGCAGAAAAGCACTTTTAAAGT
ATGTTAGAAGGAAATGAAGAAAACTAGGATTAGCAAGAATAGCATCAAGAAGAATAGTAG
CCATAATAACCAGTAGAAGAATAAGAAGTAGAAGATGATTAGTAATAAAAGTAACTTAAC
AGGCAATAAGCTGATGAAGAAATCCAAAAGAGCTTAGTTGCTTCATTATAATAATAGCAA
TAATTATAATAATAATAGCAATAATTATAATAATAATAATAATAATAATAGCAGTAGTAA
CAATAATAGCAATAGCAATAGGCAGCTACATCTACAAGCACTGCCCCTGTTAGTGCAGCT
AAATCACTTACTGATCAAAAACTAAATATTTTAGAATCTACATCAGAATAAAAAAAGGGT
GGTAAGAGCGCTTTGGAAATAGCATTTTAACATGAAATCGCTCCTAAGATAGCTAAAAAA
TAAGATTTCACTAATACTTTCTTTGTGCGTGACAATTTGAAATACATTGAGGAAAGCATA
AATGAAAATGATGACAACAATAATTTCCCTAACAAAAGCTCTTTAATTATTAACACAATT
TTATCTTGTTTTGAAGACGAAAATTAAATTGTAAGAAGAAATATTCTTGATTTAATGTAT
CACCACTTAAGGATAAATCATAGAATACTCTCTAGAGATGATTAACTAATTTTAGTTGAA
GGTGTGCTTTATTTGTTAATTAGAAAAGATGTTTCAGTTACAAGAAGAGTCAATGTTTGG
CTTTTTGGAAAACCAGATATGGACAACAAGTACACAATAACTAAAAGCAGAGAATTTGTA
GTTGATTTGTTGATTGATGCTTTCAAGAGAATTTTCAGTGTAGAGCCTTAAGATAAGGTA
GCTGCTTTATAGCCAATTAAAATTATGCAATAGTTCTACATGGAACATGAAAATTTAGTA
GAAATTACTCTTAGCAAATTAGCTATCTCATTTGTCAAATATGTTTACACTCACACATAG
AATATGCAATTTTCAGCTGATGTCTTAAAGAGTGGTATTAGATTTATGGAAAATATCTAA
GGACAGCTTAATTCTTTATTGAAGAGTATCTCAGAAGAAGCAGTTTAACTTTTAAGAGAG
AAGAAAGATGATTAATGCTTGGAAATTATTAATCTTATTGAGTTTACCTATGAAAATCTT
CTTGCTTCTGAAGATTCCTTTGATCCTATGTAATAAAGAGATTGTATTAAGGAAACTTTG
TCAAGATTATTTATCTCTTTAAGCTATCTTGATGAAAAAAATATCCAAGAATTCCATTCA
CTTGAACCAACTTTGAAGGTTATTTACAAGCTTATGCTTAAATTAGAAAGTGCTGAAGCA
AAAATTAAAGCAATCGAGAAAAAAGAAAAGAAATAATTAGAAATTACAAATGAATAAAAA
GAAATAGCATAATATCTTGATGAATGCTCTGAAAAATACTTTAATTTCTATGGTAAACTC
AGTAACGAGTTAGAAAATTTCAAGTCAAATAATATCTACAAATTAGCTTCTCAGAGCTTA
GTTAAGCTCTAAAAGTTCTTGTTCGACAAAAAGAAAATGACTCAGCTTCCTTAATGGTTT
AAATGCATCTCTCAATCCATTAAAATTACTAATCCTAATCTTTCTCTTATTGCCATTGAG
TCCATGATTGAAATTATGATTTCCGAAAAAATTGATCCCATCTATGAGTAATTGAAAGTC
CTAATTATTGATGAAGCCAAGCTAAAATACTCTAAGAAAAACGAACTTGTAGCTGGTAAT
GATTACACTAAATTGACTCTAGAAAAGCTCTGGAGTTTACTAGATTTCTAGCATTTCTAC
GATAGAATCATCGATTTAATTATCTATTTCTCCAAGTAAAATACTCAAGATATTTATATT
CATAACTTTCTCCTTTTTTCACTGACATAAATAAATAAATATTCATTTTTTATAACTAAA
TAGATATTTCCCACAATACTTTAAAGAAGTTGTAGTCAATAGTTTCCAAGCTGTCTCTAT
TACTGAAAAAGAAGCTTCAATTAGAAGATTTGCTGTTTTCTGGAGATTAACAGCCCACCA
CAAATCAAAATTACTCCTTTCTGAGTTAAATAAAGTAAAACATAAAAATAATTCTTTTAT
TCATTGACTTAAAATTAAAATTATTTTGAAAATTATTTATTTACTGAATATTTAAAAAAT
ATTTTTTCCAACTATTATTTCCATTTTAAATAAAATTACAATGTTTTTTATATATAAAAT
TTAAAAAAAATTATTTAAGGATTCATTTATTTTCTAAGCAATTCATTTTATTTTTTTATT
GAGCCAAAAAACTCATTTTATCATTTTAACTTAGACAATATTTAATTTTATTTTTTTTAA
TCAAGGTTGGTCTTTTTATTATGTTAGACTTTTTAGATCATGATAATCCTTTAATTAGAC
ATGCTTCTAAGAATTGGTTGATGGAGAGTGTCCCTCAATTTTACAGAATTATTGATCCTT
TGTTTGAGGTGCTTCTGTAAGCTAATAGCAGCTGGTATGTTACTGATAGCTACTAAGTTT
TTTATACTAAAATTTACGAGACCACTCGTGCTAATGAAACTTTCAGAAAATTAAAGAGCA
TTCTAATTATTGCTAGTGACGTTTTCTTAAAGTACATTTCTTCTTATCAGTTGAGCCCAC
TTCTTTAGGATATGAAGTCCCACTTTACTGATAAAAATCAAGCCGTTTTACTTAGAAAGC
TTGGAGCTACTATGAGCTATTTCAGTACAATTAATCCTAATTTGAATTCTTTAGATATGA
CTAGTTCACAATCTACAGCTGTAAACGATAAAAAGGTTACTGACTTAAAGATGACTTACT
TAGATTTGTTGATAATTGTTTGCCTTCGTTATATTTAAGGATAAGCTTTGGAAAGTTTGT
CATTGAAATTCTAAGTTGAAAATGCTGCTGTTAATGCTTCTGCATGTGAATATATGGAAT
TATTAATTACTCATCTTGAAGATGCTCCATTATGTTTGGCTCTTTGTGAGTATCTCATGG
AGCCTCTTTTGACTATTTTAGGTCACTGCATTACAAACAGAGACTACGTCATGCAAGTAC
AATTACTGAATGTTTTTAGAATAATATTCTTCCATTCTTCGTACATAAAGAAGAATAATA
CTGAAGAAATCAAATTTAAACTTGTTTAAACTCTTTCAAATAAATTATTTATTCCTAACA
TTTTGAAAGGTTTAATGACTTCTATCCCTTACGTTAGATCTTAATTTATTTCATTTATCA
GCGCTTGTATTCCACTCTTGAGTACATATTTAGCCTCTAACCAACTAACCAGTATTATAA
AGTCAATTATGTTTACCTACTTTTCTTTGATCAAGCACTTGGCTACTACTCCTGCTCAAG
ATAACGATGAATCTATGGTCACTATAAGCAAAACTTAAATTATTAAACAGCCTTCATTGA
TTAAACAAAATAAAACCGTTATTCTCATCCAAACTTAGGAGGTAGTTAAGGAAGACTCTA
ATATTTATGAGATACACACAGTTTTAGAAGGTGTCAGAACTATTCTCTAATTCTTCCTTA
AAATTAGAACTCTTGAAGAAATTGAATCTAGTAAAAAAGATCAAAGCGGTGGATTTGCTA
ACCTCATGAAAACTGTACTCACACTTGGTTTAGCTGGAAGTGGAAATGCTAATGACAAAG
ACAAAGATGGCAAAGTAAATAAATAATTTTTAAAAATTTACAAATTTTTTTTATTTTTTG
GTTTTCAGGAAGCATCTTCTTTTATATAACATCAAAAAAGAAAAAGATTATCAAGGAGAA
GCTACTTGGAGGCCGATTTATAATTAATAAGGCAATTAAAAATATAACTACAATTTCTAC
AATTATCATAAAAAATTACAAATTAATAAGAAGTAAATGAAAAATAAGCAATCAACTATC
ATGAGAAATCTTTCAATTTTTAGATTTTCTTTTAATTCCTTTTATTTCATCAAATACAAA
AAATATAAATTAAAACATATTTTTTTAATAAATGCTTTAAAAAATCAATCAATCTGAAAT
AAATATTAGAAAAATAAATAAACTTTATTTAAAGGATAGAAATTAATTTTTTAATTTTTT
CGAAAATTAGGCATTCTTTGAGAAATATCCTGATACTTGTAAGAGTTTGCTATATGATAT
CAAGTAAGTCGTTGAATTGTTTATTAACAGTTGGCAAACAACTCCAGAATTTATTACTGA
ATTCACAAGTTATGGTATCAGACCTTATGAACAAAAGAAATTCAACTCATTTAATAATTT
ATTGATGGACATGATCAAAAATGCTGAGAATGATAAACAGAGAGTTAAAATTTTAATTAT
TTCTATTATCAAACCTTTGGTATATGAATTCCCTAACGATATGATGAATTCCTTTTTACT
TTTATGGAACCGTAGCTGCATGACTGACCCACCAAATGCCCACAAGGATTTCAACTAAAA
CGAATTCTTAAAGAAAATGATAGAAATGATAACTATTTTAAATATTCCCAATGAACTTTT
CTTAGAATCATTCTATCAAAGCTTTATCAGTGAAATCATTCAAAAATTCTACCAACAAAA
GAACACTAAAGAAAAGAAAAATGTTTACTTCTTAAACTATGAAATTGCTCAACACGAGTC
TAAGCTCCTTTACTTCCTTTACATATATCTTTCATATACTTACATTGACAGCAATATTCT
TAAAAAAGAAAACCTTCTACTATTCTGGAACATTATCCTTAAAATCTTAAAAGTAATTTT
TATAAATATTAAAAATCATAATTTAACTTATTATTTTAAATAATGATAATAGATATTCTA
ACCCTCTAAAAATCCTAACACTGTGATGTGGATGCTTGATCTTTTGTACATGTTGAGTGA
AAAGTACTCTCCAAAGGAAATTTTATCAGATAGTAAGTTCAAGAAGGAATTGCACGATTT
GATAAATGAAAAGCTTTCTTACTTGTCTGGCTGGATTGCTAACGTTTACTAAGTCAAATT
TAACGAACCTTCTGCTTAAACTTAATAGTCTTTGAATAATGCAGTTGATTAACACATGAA
GGAAATGATTGTACAGAGCTTACAATAATATAGAATAATATCTCCTTACTCTCCTACTTT
TTACGAAATTAGTTTATCATTTTACAGTCAAATACACATTTTAGAGCATGCCCCTAAAAG
TATTGCTAACTAGATGAAGGAATTGTAGATGAATTAATTGGATCAATTCATCTTTGATCG
CATTGATACTGTTGACGAAAATGCTGTTTATGATAAATACAGATTAATTTGTTTGGAAAC
CCTCAAAACATTGTCTCTTGAGTTACTCTAAAATACTTACTCTCCAGAAAGATAGGACAG
AGTTGTCGTTCGTGTTAAGGAGTTTGTTGATCCCTTATATGCTGTTATTGAAAACAAAGG
AAGCACAAATTCTTACTTCCTTGAAAGTACTTCAGAGCTCATTTGTAGCTTGATCGAGAA
AGCTCCTTCTCTCTTGATTAAAGATTTCAGAAAAAGTATCTTAGAAATGTTTAACAAAGA
TAACTTCTTCTCTTGCAATAAGGGTACTTTGCGTTACTGGGGAAAAATTATAGATTATGT
TCTTACTCAAGATAAATCTAATGACCTTTTCAATGAATATCTTGAAAAAGTAAGTCTTTC
TGCTGGTTTCTTTGCTCGTGAATAGAATGAAAACAAAAAGAAAATAAAGGCTTTCAAAAG
AACTTGCTTTATCATCTTTTCAGGTGCCAAGGACAAATATGCCAATCGTTTACGTAAACT
TTTAGACAGTATCGCAGAAGTCATTAAAACAACTGATAGCTCTTAATCTTCTTTGCTTAT
ATTAATTCTTTTCTGCATTCGTATATTGATTCTTCGTCTATCTCAAAGCAACTTAAATGA
ACTCTTCAGACAAATCTGGCCCATTTTGCTTACATTGTTGATTCAAATATATTCAAAACC
ACTTCCTGGTCAACCTCCCCGTAATCCTAACTTGATGCTTGCTGGTTTGAAATTAATTGA
AATTCTCTCAGTTGCTCAACTAGATGAGTTCTTCTTGCATCAATGGATGTTTATTTTTGA
TTATTTCGGTCTTAAATTATAACCTTTGTCCTAATAAGAGCGTGAAAACCAAATCAGATT
AAGAGGCTAAATGAATGAAGCATAGCTAAGATAATATGCGAAAATATCTCCTTTCTACTT
CTAGCCTTTCGTTTCTACTTGTCTTAATGAGTAGGATTTAGGAGTTAAGTATGTAAATCA
ACCAATAGATGAATCAGAATAATCAGAATAAATTACATATCAAAAGAAACAACGTAAATT
AATTATGACTTAATGTAAAGTAGATGATGAAAATGAACTAAAGAGCCATGCTTTATCTCT
CTGTCAATATTTAATTTCAAATAACGAAAACCGTACAGAAATAGACTTTAACTCAATCGA
AGCCTTGATAGAGGATGACTTCATCAATTTAGATGAACACATTTTGAAGGTTTGA