Identifiers and Description

Gene Model Identifier

TTHERM_00758980

Standard Name

DOP1 (DOPey domain-containing protein 1)

Aliases

PreTt08195 | 124.m00113 | 3821.m00528

Description

Dopey domain-containing protein; interrupted by TPB1-dependent IES

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00758980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20878.19.997093137033517e-262hypothetical protein (2160 aa)
OxytrichaContig10767.0.g783.999582750711782e-108Dopey, N-terminal
DictyBaseDDB_G02931281.9993007828132465e-27DDB_G0293128 on chromosome: 6
position 2567187 to 2574265
WormBaseWBGene000039051.9991095569230066e-20locus:pad-1 Protein pad-1
status:Confirmed UniProt:Q9X
W10 protein_id:CAA22324.2
Stentor CoeruleusSteCoe_271330.00000000027894680928689246
SGDYDR141C0.0000000039998859049333245DOP1 Golgi-localized, leucine-
zipper domain containing prote
in; involved in endosome to Go
lgi transport, organization of
the ER, establishing cell pol
arity, and morphogenesis; dete
cted in highly purified mitoch
ondria in high-throughput stud
ies

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28087716: Cheng CY, Young JM, Lin CG, Chao JL, Malik HS, Yao MC (2016) The piggyBac transposon-derived genes TPB1 and TPB6 mediate essential transposon-like excision during the developmental rearrangement of key genes in Tetrahymena thermophila. Genes & development 30(24):2724-2736

Sequences

>TTHERM_00758980(coding)
ATGGATAAAACAAAACAAATCGAAAAGTCATCCCAGCTGAATAAGCAGCTCAATACACTT
CTTAGTGGATTCGAAAAAAATAAGGCATGGTCAGATATTGGTACTTGGCTCTATAAGGTT
GAGCAAGCTATGAAGGAAAACCCAAGTCCTTATATAAGCGAAAAGCTTTCTTTGGCAAAG
AGATTAGCACAGTGTCTTAATCCAGTCTTGCCATAAGCTATTAATTTGCAGACACTTAAA
ATTTATGAGCTTATCTTCGAAAATATAAAAATAGCTTCCCAAGGCAATGTAGAAGAATAC
AAGAAGATGTTCTGTGAAGACATTGGTATTTACAGTGTTGGTCTCTTCCCCTTCTTTTAG
AATGCTCATTAAAAGAATAAACATCAATTCTTAGAAATTATTCGTAATTATTACATACCT
GTAGGAAGAGATTTGATACCATGTCTTCCTGGTCTTGTGCTATCTATACTTCCTGGTTTA
GAAGAGTAGAGCGAAATTTTAATTAAAGATGTTACCAAAACTTTAGAAGCCATCATGACT
TCCTGTGGTAGAAGATACTTTTTAGGTAGTGTCTGGATGGGTATCAAGAGAACTCAAAGA
GGAAGAGAACACGCAATTAAGTTTTTGACCAAGCTCCTTCCCAAAGTTAAATATGAAGAA
GATGAAGAAGAAAATTAAGATGCAAGCGATAATTCTTCAAATTTTTCAGAGGATAATTAT
GAAGAATTTGATGAGACTAAGTTTAAAGAGCAACAGAAAAAAGAATAGACATAAACTGTG
GAATAGACTCCTGTCAAGCAAAACTAATCGCCTAAATTTTAAGAGCAACAAGCAGAGTAA
GCAGATCAAGTAGATCATGATTAATAAAATAATTAGGTAGAAATTCAAGATGAAGAAAAA
ATCGCATAAGACTTGATTTAATAAGCTTAAGCTGAAGCAGAAAAGCACTTTTAAAGTATG
TTAGAAGGAAATGAAGAAAACTAGGATTAGCAAGAATAGCATCAAGAAGAATAGTAGCCA
TAATAACCAGTAGAAGAATAAGAAGTAGAAGATGATTAGTAATAAAAGTAACTTAACAGG
CAATAAGCTGATGAAGAAATCCAAAAGAGCTTAGTTGCTTCATTATAATAATAGCAATAA
TTATAATAATAATAGCAATAATTATAATAATAATAATAATAATAATAGCAGTAGTAACAA
TAATAGCAATAGCAATAGGCAGCTACATCTACAAGCACTGCCCCTGTTAGTGCAGCTAAA
TCACTTACTGATCAAAAACTAAATATTTTAGAATCTACATCAGAATAAAAAAAGGGTGGT
AAGAGCGCTTTGGAAATAGCATTTTAACATGAAATCGCTCCTAAGATAGCTAAAAAATAA
GATTTCACTAATACTTTCTTTGTGCGTGACAATTTGAAATACATTGAGGAAAGCATAAAT
GAAAATGATGACAACAATAATTTCCCTAACAAAAGCTCTTTAATTATTAACACAATTTTA
TCTTGTTTTGAAGACGAAAATTAAATTGTAAGAAGAAATATTCTTGATTTAATGTATCAC
CACTTAAGGATAAATCATAGAATACTCTCTAGAGATGATTAACTAATTTTAGTTGAAGGT
GTGCTTTATTTGTTAATTAGAAAAGATGTTTCAGTTACAAGAAGAGTCAATGTTTGGCTT
TTTGGAAAACCAGATATGGACAACAAGTACACAATAACTAAAAGCAGAGAATTTGTAGTT
GATTTGTTGATTGATGCTTTCAAGAGAATTTTCAGTGTAGAGCCTTAAGATAAGGTAGCT
GCTTTATAGCCAATTAAAATTATGCAATAGTTCTACATGGAACATGAAAATTTAGTAGAA
ATTACTCTTAGCAAATTAGCTATCTCATTTGTCAAATATGTTTACACTCACACATAGAAT
ATGCAATTTTCAGCTGATGTCTTAAAGAGTGGTATTAGATTTATGGAAAATATCTAAGGA
CAGCTTAATTCTTTATTGAAGAGTATCTCAGAAGAAGCAGTTTAACTTTTAAGAGAGAAG
AAAGATGATTAATGCTTGGAAATTATTAATCTTATTGAGTTTACCTATGAAAATCTTCTT
GCTTCTGAAGATTCCTTTGATCCTATGTAATAAAGAGATTGTATTAAGGAAACTTTGTCA
AGATTATTTATCTCTTTAAGCTATCTTGATGAAAAAAATATCCAAGAATTCCATTCACTT
GAACCAACTTTGAAGGTTATTTACAAGCTTATGCTTAAATTAGAAAGTGCTGAAGCAAAA
ATTAAAGCAATCGAGAAAAAAGAAAAGAAATAATTAGAAATTACAAATGAATAAAAAGAA
ATAGCATAATATCTTGATGAATGCTCTGAAAAATACTTTAATTTCTATGGTAAACTCAGT
AACGAGTTAGAAAATTTCAAGTCAAATAATATCTACAAATTAGCTTCTCAGAGCTTAGTT
AAGCTCTAAAAGTTCTTGTTCGACAAAAAGAAAATGACTCAGCTTCCTTAATGGTTTAAA
TGCATCTCTCAATCCATTAAAATTACTAATCCTAATCTTTCTCTTATTGCCATTGAGTCC
ATGATTGAAATTATGATTTCCGAAAAAATTGATCCCATCTATGAGTAATTGAAAGTCCTA
ATTATTGATGAAGCCAAGCTAAAATACTCTAAGAAAAACGAACTTGTAGCTGGTAATGAT
TACACTAAATTGACTCTAGAAAAGCTCTGGAGTTTACTAGATTTCTAGCATTTCTACGAT
AGAATCATCGATTTAATTATCTATTTCTCCAAATATTTCCCACAATACTTTAAAGAAGTT
GTAGTCAATAGTTTCCAAGCTGTCTCTATTACTGAAAAAGAAGCTTCAATTAGAAGATTT
GCTGTTTTCTGGAGATTAACAGCCCACCACAAATCAAAATTACTCCTTTCTGAGTTAAAT
AAAGTTGGTCTTTTTATTATGTTAGACTTTTTAGATCATGATAATCCTTTAATTAGACAT
GCTTCTAAGAATTGGTTGATGGAGAGTGTCCCTCAATTTTACAGAATTATTGATCCTTTG
TTTGAGGTGCTTCTGTAAGCTAATAGCAGCTGGTATGTTACTGATAGCTACTAAGTTTTT
TATACTAAAATTTACGAGACCACTCGTGCTAATGAAACTTTCAGAAAATTAAAGAGCATT
CTAATTATTGCTAGTGACGTTTTCTTAAAGTACATTTCTTCTTATCAGTTGAGCCCACTT
CTTTAGGATATGAAGTCCCACTTTACTGATAAAAATCAAGCCGTTTTACTTAGAAAGCTT
GGAGCTACTATGAGCTATTTCAGTACAATTAATCCTAATTTGAATTCTTTAGATATGACT
AGTTCACAATCTACAGCTGTAAACGATAAAAAGGTTACTGACTTAAAGATGACTTACTTA
GATTTGTTGATAATTGTTTGCCTTCGTTATATTTAAGGATAAGCTTTGGAAAGTTTGTCA
TTGAAATTCTAAGTTGAAAATGCTGCTGTTAATGCTTCTGCATGTGAATATATGGAATTA
TTAATTACTCATCTTGAAGATGCTCCATTATGTTTGGCTCTTTGTGAGTATCTCATGGAG
CCTCTTTTGACTATTTTAGGTCACTGCATTACAAACAGAGACTACGTCATGCAAGTACAA
TTACTGAATGTTTTTAGAATAATATTCTTCCATTCTTCGTACATAAAGAAGAATAATACT
GAAGAAATCAAATTTAAACTTGTTTAAACTCTTTCAAATAAATTATTTATTCCTAACATT
TTGAAAGGTTTAATGACTTCTATCCCTTACGTTAGATCTTAATTTATTTCATTTATCAGC
GCTTGTATTCCACTCTTGAGTACATATTTAGCCTCTAACCAACTAACCAGTATTATAAAG
TCAATTATGTTTACCTACTTTTCTTTGATCAAGCACTTGGCTACTACTCCTGCTCAAGAT
AACGATGAATCTATGGTCACTATAAGCAAAACTTAAATTATTAAACAGCCTTCATTGATT
AAACAAAATAAAACCGTTATTCTCATCCAAACTTAGGAGGTAGTTAAGGAAGACTCTAAT
ATTTATGAGATACACACAGTTTTAGAAGGTGTCAGAACTATTCTCTAATTCTTCCTTAAA
ATTAGAACTCTTGAAGAAATTGAATCTAGTAAAAAAGATCAAAGCGGTGGATTTGCTAAC
CTCATGAAAACTGTACTCACACTTGGTTTAGCTGGAAGTGGAAATGCTAATGACAAAGAC
AAAGATGGCAAAGCATTCTTTGAGAAATATCCTGATACTTGTAAGAGTTTGCTATATGAT
ATCAAGTAAGTCGTTGAATTGTTTATTAACAGTTGGCAAACAACTCCAGAATTTATTACT
GAATTCACAAGTTATGGTATCAGACCTTATGAACAAAAGAAATTCAACTCATTTAATAAT
TTATTGATGGACATGATCAAAAATGCTGAGAATGATAAACAGAGAGTTAAAATTTTAATT
ATTTCTATTATCAAACCTTTGGTATATGAATTCCCTAACGATATGATGAATTCCTTTTTA
CTTTTATGGAACCGTAGCTGCATGACTGACCCACCAAATGCCCACAAGGATTTCAACTAA
AACGAATTCTTAAAGAAAATGATAGAAATGATAACTATTTTAAATATTCCCAATGAACTT
TTCTTAGAATCATTCTATCAAAGCTTTATCAGTGAAATCATTCAAAAATTCTACCAACAA
AAGAACACTAAAGAAAAGAAAAATGTTTACTTCTTAAACTATGAAATTGCTCAACACGAG
TCTAAGCTCCTTTACTTCCTTTACATATATCTTTCATATACTTACATTGACAGCAATATT
CTTAAAAAAGAAAACCTTCTACTATTCTGGAACATTATCCTTAAAATCTTAAAAATATTC
TAACCCTCTAAAAATCCTAACACTGTGATGTGGATGCTTGATCTTTTGTACATGTTGAGT
GAAAAGTACTCTCCAAAGGAAATTTTATCAGATAGTAAGTTCAAGAAGGAATTGCACGAT
TTGATAAATGAAAAGCTTTCTTACTTGTCTGGCTGGATTGCTAACGTTTACTAAGTCAAA
TTTAACGAACCTTCTGCTTAAACTTAATAGTCTTTGAATAATGCAGTTGATTAACACATG
AAGGAAATGATTGTACAGAGCTTACAATAATATAGAATAATATCTCCTTACTCTCCTACT
TTTTACGAAATTAGTTTATCATTTTACAGTCAAATACACATTTTAGAGCATGCCCCTAAA
AGTATTGCTAACTAGATGAAGGAATTGTAGATGAATTAATTGGATCAATTCATCTTTGAT
CGCATTGATACTGTTGACGAAAATGCTGTTTATGATAAATACAGATTAATTTGTTTGGAA
ACCCTCAAAACATTGTCTCTTGAGTTACTCTAAAATACTTACTCTCCAGAAAGATAGGAC
AGAGTTGTCGTTCGTGTTAAGGAGTTTGTTGATCCCTTATATGCTGTTATTGAAAACAAA
GGAAGCACAAATTCTTACTTCCTTGAAAGTACTTCAGAGCTCATTTGTAGCTTGATCGAG
AAAGCTCCTTCTCTCTTGATTAAAGATTTCAGAAAAAGTATCTTAGAAATGTTTAACAAA
GATAACTTCTTCTCTTGCAATAAGGGTACTTTGCGTTACTGGGGAAAAATTATAGATTAT
GTTCTTACTCAAGATAAATCTAATGACCTTTTCAATGAATATCTTGAAAAAGTAAGTCTT
TCTGCTGGTTTCTTTGCTCGTGAATAGAATGAAAACAAAAAGAAAATAAAGGCTTTCAAA
AGAACTTGCTTTATCATCTTTTCAGGTGCCAAGGACAAATATGCCAATCGTTTACGTAAA
CTTTTAGACAGTATCGCAGAAGTCATTAAAACAACTGATAGCTCTTAATCTTCTTTGCTT
ATATTAATTCTTTTCTGCATTCGTATATTGATTCTTCGTCTATCTCAAAGCAACTTAAAT
GAACTCTTCAGACAAATCTGGCCCATTTTGCTTACATTGTTGATTCAAATATATTCAAAA
CCACTTCCTGGTCAACCTCCCCGTAATCCTAACTTGATGCTTGCTGGTTTGAAATTAATT
GAAATTCTCTCAGTTGCTCAACTAGATGAGTTCTTCTTGCATCAATGGATGTTTATTTTT
GATTATTTCGGTCTTAAATTATAACCTTTGTCCTAATAAGAGCGTGAAAACCAAATCAGA
TTAAGAGGCTAAATGAATGAAGCATAGCTAAGATAATATGCGAAAATATCTCCTTTCTAC
TTCTAGCCTTTCGTTTCTACTTGTCTTAATGAGTAGGATTTAGGAGTTAAGTATGTAAAT
CAACCAATAGATGAATCAGAATAATCAGAATAAATTACATATCAAAAGAAACAACGTAAA
TTAATTATGACTTAATGTAAAGTAGATGATGAAAATGAACTAAAGAGCCATGCTTTATCT
CTCTGTCAATATTTAATTTCAAATAACGAAAACCGTACAGAAATAGACTTTAACTCAATC
GAAGCCTTGATAGAGGATGACTTCATCAATTTAGATGAACACATTTTGAAGGTTTGA


>TTHERM_00758980(protein)
MDKTKQIEKSSQLNKQLNTLLSGFEKNKAWSDIGTWLYKVEQAMKENPSPYISEKLSLAK
RLAQCLNPVLPQAINLQTLKIYELIFENIKIASQGNVEEYKKMFCEDIGIYSVGLFPFFQ
NAHQKNKHQFLEIIRNYYIPVGRDLIPCLPGLVLSILPGLEEQSEILIKDVTKTLEAIMT
SCGRRYFLGSVWMGIKRTQRGREHAIKFLTKLLPKVKYEEDEEENQDASDNSSNFSEDNY
EEFDETKFKEQQKKEQTQTVEQTPVKQNQSPKFQEQQAEQADQVDHDQQNNQVEIQDEEK
IAQDLIQQAQAEAEKHFQSMLEGNEENQDQQEQHQEEQQPQQPVEEQEVEDDQQQKQLNR
QQADEEIQKSLVASLQQQQQLQQQQQQLQQQQQQQQQQQQQQQQQQAATSTSTAPVSAAK
SLTDQKLNILESTSEQKKGGKSALEIAFQHEIAPKIAKKQDFTNTFFVRDNLKYIEESIN
ENDDNNNFPNKSSLIINTILSCFEDENQIVRRNILDLMYHHLRINHRILSRDDQLILVEG
VLYLLIRKDVSVTRRVNVWLFGKPDMDNKYTITKSREFVVDLLIDAFKRIFSVEPQDKVA
ALQPIKIMQQFYMEHENLVEITLSKLAISFVKYVYTHTQNMQFSADVLKSGIRFMENIQG
QLNSLLKSISEEAVQLLREKKDDQCLEIINLIEFTYENLLASEDSFDPMQQRDCIKETLS
RLFISLSYLDEKNIQEFHSLEPTLKVIYKLMLKLESAEAKIKAIEKKEKKQLEITNEQKE
IAQYLDECSEKYFNFYGKLSNELENFKSNNIYKLASQSLVKLQKFLFDKKKMTQLPQWFK
CISQSIKITNPNLSLIAIESMIEIMISEKIDPIYEQLKVLIIDEAKLKYSKKNELVAGND
YTKLTLEKLWSLLDFQHFYDRIIDLIIYFSKYFPQYFKEVVVNSFQAVSITEKEASIRRF
AVFWRLTAHHKSKLLLSELNKVGLFIMLDFLDHDNPLIRHASKNWLMESVPQFYRIIDPL
FEVLLQANSSWYVTDSYQVFYTKIYETTRANETFRKLKSILIIASDVFLKYISSYQLSPL
LQDMKSHFTDKNQAVLLRKLGATMSYFSTINPNLNSLDMTSSQSTAVNDKKVTDLKMTYL
DLLIIVCLRYIQGQALESLSLKFQVENAAVNASACEYMELLITHLEDAPLCLALCEYLME
PLLTILGHCITNRDYVMQVQLLNVFRIIFFHSSYIKKNNTEEIKFKLVQTLSNKLFIPNI
LKGLMTSIPYVRSQFISFISACIPLLSTYLASNQLTSIIKSIMFTYFSLIKHLATTPAQD
NDESMVTISKTQIIKQPSLIKQNKTVILIQTQEVVKEDSNIYEIHTVLEGVRTILQFFLK
IRTLEEIESSKKDQSGGFANLMKTVLTLGLAGSGNANDKDKDGKAFFEKYPDTCKSLLYD
IKQVVELFINSWQTTPEFITEFTSYGIRPYEQKKFNSFNNLLMDMIKNAENDKQRVKILI
ISIIKPLVYEFPNDMMNSFLLLWNRSCMTDPPNAHKDFNQNEFLKKMIEMITILNIPNEL
FLESFYQSFISEIIQKFYQQKNTKEKKNVYFLNYEIAQHESKLLYFLYIYLSYTYIDSNI
LKKENLLLFWNIILKILKIFQPSKNPNTVMWMLDLLYMLSEKYSPKEILSDSKFKKELHD
LINEKLSYLSGWIANVYQVKFNEPSAQTQQSLNNAVDQHMKEMIVQSLQQYRIISPYSPT
FYEISLSFYSQIHILEHAPKSIANQMKELQMNQLDQFIFDRIDTVDENAVYDKYRLICLE
TLKTLSLELLQNTYSPERQDRVVVRVKEFVDPLYAVIENKGSTNSYFLESTSELICSLIE
KAPSLLIKDFRKSILEMFNKDNFFSCNKGTLRYWGKIIDYVLTQDKSNDLFNEYLEKVSL
SAGFFAREQNENKKKIKAFKRTCFIIFSGAKDKYANRLRKLLDSIAEVIKTTDSSQSSLL
ILILFCIRILILRLSQSNLNELFRQIWPILLTLLIQIYSKPLPGQPPRNPNLMLAGLKLI
EILSVAQLDEFFLHQWMFIFDYFGLKLQPLSQQERENQIRLRGQMNEAQLRQYAKISPFY
FQPFVSTCLNEQDLGVKYVNQPIDESEQSEQITYQKKQRKLIMTQCKVDDENELKSHALS
LCQYLISNNENRTEIDFNSIEALIEDDFINLDEHILKV


>TTHERM_00758980(gene)
ATGGATAAAACAAAACAAATCGAAAAGTCATCCCAGCTGAATAAGCAGCTCAATACACTT
CTTAGTGGATTCGAAAAAAATAAGGCATGGTCAGATATTGGTACTTGGCTCTATAAGGTT
GAGCAAGCTATGAAGGAAAACCCAAGTCCTTATATAAGCGAAAAGCTTTCTTTGGCAAAG
AGATTAGCACAGTGTCTTAATCCAGTCTTGCCATAAGCTATTAATTTGCAGACACTTAAA
ATTTATGAGCTTATCTTCGAAAATATAAAAATAGCTTCCCAAGGCAATGTAGAAGAATAC
AAGAAGATGTTCTGTGAAGACATTGGTATTTACAGTGTTGGTCTCTTCCCCTTCTTTTAG
AATGCTCATTAAAAGAATAAACATCAATTCTTAGAAATTATTCGTAATTATTACATACCT
GTAGGAAGAGATTTGATACCATGTCTTCCTGGTCTTGTGCTATCTATACTTCCTGGTTTA
GAAGAGTAGAGCGAAATTTTAATTAAAGATGTTACCAAAACTTTAGAAGCCATCATGACT
TCCTGTGGTAGAAGGTAAAAAATTTTCTACTTTTTTATCACTTAAAAGCAAAAAAATATA
AGCACGTTTTAAAACTAAAGCTATTTGTTCTTATAATGTGGCTCTTTTATTTTTATAAAA
ATAAATTAAATGCATTCAAAAATAATTTAAAAAAACATTTAAAAGTCGCCTTATAAATCA
TTTTAAGAATATCTGTATCCTATGTAGATTTTTATAATTTTCTTTTTTAAAGATACTTTT
TAGGTAGTGTCTGGATGGGTATCAAGAGAACTCAAAGAGGAAGAGAACACGCAATTAAGT
TTTTGACCAAGCTCCTTCCCAAAGTTAAATATGAAGAAGATGAAGAAGAAAATTAAGATG
CAAGCGATAATTCTTCAAATTTTTCAGAGGATAATTATGAAGAATTTGATGAGACTAAGT
TTAAAGAGCAAGTAAATAAAATTTTTTTGGATTTGGTATTTTATAAAAAAGAAAACAATT
TATTTTAAGCATTTTTGATCAAAATGCTGATAAAGCAATATAATAAAACAAAAATCTTAA
ATCATAGTTTTGATAATTAAATGAAATCATATTATTTTCAGTTATTTTTAATCAAAAATG
ATTGATCTATTTAATTTGGAATTTTAGTCAGCAAAGATATTATTTTTGTAAGATATTCGA
TGTATTTATTTATGATTTTTATTCAATTTAAAACAGCAGAAAAAAGAATAGACATAAACT
GTGGAATAGACTCCTGTCAAGCAAAACTAATCGCCTAAATTTTAAGAGCAACAAGCAGAG
TAAGCAGATCAAGTAGATCATGATTAATAAAATAATTAGGTAGAAATTCAAGATGAAGAA
AAAATCGCATAAGACTTGATTTAATAAGCTTAAGCTGAAGCAGAAAAGCACTTTTAAAGT
ATGTTAGAAGGAAATGAAGAAAACTAGGATTAGCAAGAATAGCATCAAGAAGAATAGTAG
CCATAATAACCAGTAGAAGAATAAGAAGTAGAAGATGATTAGTAATAAAAGTAACTTAAC
AGGCAATAAGCTGATGAAGAAATCCAAAAGAGCTTAGTTGCTTCATTATAATAATAGCAA
TAATTATAATAATAATAGCAATAATTATAATAATAATAATAATAATAATAGCAGTAGTAA
CAATAATAGCAATAGCAATAGGCAGCTACATCTACAAGCACTGCCCCTGTTAGTGCAGCT
AAATCACTTACTGATCAAAAACTAAATATTTTAGAATCTACATCAGAATAAAAAAAGGGT
GGTAAGAGCGCTTTGGAAATAGCATTTTAACATGAAATCGCTCCTAAGATAGCTAAAAAA
TAAGATTTCACTAATACTTTCTTTGTGCGTGACAATTTGAAATACATTGAGGAAAGCATA
AATGAAAATGATGACAACAATAATTTCCCTAACAAAAGCTCTTTAATTATTAACACAATT
TTATCTTGTTTTGAAGACGAAAATTAAATTGTAAGAAGAAATATTCTTGATTTAATGTAT
CACCACTTAAGGATAAATCATAGAATACTCTCTAGAGATGATTAACTAATTTTAGTTGAA
GGTGTGCTTTATTTGTTAATTAGAAAAGATGTTTCAGTTACAAGAAGAGTCAATGTTTGG
CTTTTTGGAAAACCAGATATGGACAACAAGTACACAATAACTAAAAGCAGAGAATTTGTA
GTTGATTTGTTGATTGATGCTTTCAAGAGAATTTTCAGTGTAGAGCCTTAAGATAAGGTA
GCTGCTTTATAGCCAATTAAAATTATGCAATAGTTCTACATGGAACATGAAAATTTAGTA
GAAATTACTCTTAGCAAATTAGCTATCTCATTTGTCAAATATGTTTACACTCACACATAG
AATATGCAATTTTCAGCTGATGTCTTAAAGAGTGGTATTAGATTTATGGAAAATATCTAA
GGACAGCTTAATTCTTTATTGAAGAGTATCTCAGAAGAAGCAGTTTAACTTTTAAGAGAG
AAGAAAGATGATTAATGCTTGGAAATTATTAATCTTATTGAGTTTACCTATGAAAATCTT
CTTGCTTCTGAAGATTCCTTTGATCCTATGTAATAAAGAGATTGTATTAAGGAAACTTTG
TCAAGATTATTTATCTCTTTAAGCTATCTTGATGAAAAAAATATCCAAGAATTCCATTCA
CTTGAACCAACTTTGAAGGTTATTTACAAGCTTATGCTTAAATTAGAAAGTGCTGAAGCA
AAAATTAAAGCAATCGAGAAAAAAGAAAAGAAATAATTAGAAATTACAAATGAATAAAAA
GAAATAGCATAATATCTTGATGAATGCTCTGAAAAATACTTTAATTTCTATGGTAAACTC
AGTAACGAGTTAGAAAATTTCAAGTCAAATAATATCTACAAATTAGCTTCTCAGAGCTTA
GTTAAGCTCTAAAAGTTCTTGTTCGACAAAAAGAAAATGACTCAGCTTCCTTAATGGTTT
AAATGCATCTCTCAATCCATTAAAATTACTAATCCTAATCTTTCTCTTATTGCCATTGAG
TCCATGATTGAAATTATGATTTCCGAAAAAATTGATCCCATCTATGAGTAATTGAAAGTC
CTAATTATTGATGAAGCCAAGCTAAAATACTCTAAGAAAAACGAACTTGTAGCTGGTAAT
GATTACACTAAATTGACTCTAGAAAAGCTCTGGAGTTTACTAGATTTCTAGCATTTCTAC
GATAGAATCATCGATTTAATTATCTATTTCTCCAAGTAAAATACTCAAGATATTTATATT
CATAACTTTCTCCTTTTTTCACTGACATAAATAAATAAATATTCATTTTTTATAACTAAA
TAGATATTTCCCACAATACTTTAAAGAAGTTGTAGTCAATAGTTTCCAAGCTGTCTCTAT
TACTGAAAAAGAAGCTTCAATTAGAAGATTTGCTGTTTTCTGGAGATTAACAGCCCACCA
CAAATCAAAATTACTCCTTTCTGAGTTAAATAAAGTAAAACATAAAAATAATTCTTTTAT
TCATTGACTTAAAATTAAAATTATTTTGAAAATTATTTATTTACTGAATATTTAAAAAAT
ATTTTTTCCAACTATTATTTCCATTTTAAATAAAATTACAATGTTTTTTATATATAAAAT
TTAAAAAAAATTATTTAAGGATTCATTTATTTTCTAAGCAATTCATTTTATTTTTTTATT
GAGCCAAAAAACTCATTTTATCATTTTAACTTAGACAATATTTAATTTTATTTTTTTTAA
TCAAGGTTGGTCTTTTTATTATGTTAGACTTTTTAGATCATGATAATCCTTTAATTAGAC
ATGCTTCTAAGAATTGGTTGATGGAGAGTGTCCCTCAATTTTACAGAATTATTGATCCTT
TGTTTGAGGTGCTTCTGTAAGCTAATAGCAGCTGGTATGTTACTGATAGCTACTAAGTTT
TTTATACTAAAATTTACGAGACCACTCGTGCTAATGAAACTTTCAGAAAATTAAAGAGCA
TTCTAATTATTGCTAGTGACGTTTTCTTAAAGTACATTTCTTCTTATCAGTTGAGCCCAC
TTCTTTAGGATATGAAGTCCCACTTTACTGATAAAAATCAAGCCGTTTTACTTAGAAAGC
TTGGAGCTACTATGAGCTATTTCAGTACAATTAATCCTAATTTGAATTCTTTAGATATGA
CTAGTTCACAATCTACAGCTGTAAACGATAAAAAGGTTACTGACTTAAAGATGACTTACT
TAGATTTGTTGATAATTGTTTGCCTTCGTTATATTTAAGGATAAGCTTTGGAAAGTTTGT
CATTGAAATTCTAAGTTGAAAATGCTGCTGTTAATGCTTCTGCATGTGAATATATGGAAT
TATTAATTACTCATCTTGAAGATGCTCCATTATGTTTGGCTCTTTGTGAGTATCTCATGG
AGCCTCTTTTGACTATTTTAGGTCACTGCATTACAAACAGAGACTACGTCATGCAAGTAC
AATTACTGAATGTTTTTAGAATAATATTCTTCCATTCTTCGTACATAAAGAAGAATAATA
CTGAAGAAATCAAATTTAAACTTGTTTAAACTCTTTCAAATAAATTATTTATTCCTAACA
TTTTGAAAGGTTTAATGACTTCTATCCCTTACGTTAGATCTTAATTTATTTCATTTATCA
GCGCTTGTATTCCACTCTTGAGTACATATTTAGCCTCTAACCAACTAACCAGTATTATAA
AGTCAATTATGTTTACCTACTTTTCTTTGATCAAGCACTTGGCTACTACTCCTGCTCAAG
ATAACGATGAATCTATGGTCACTATAAGCAAAACTTAAATTATTAAACAGCCTTCATTGA
TTAAACAAAATAAAACCGTTATTCTCATCCAAACTTAGGAGGTAGTTAAGGAAGACTCTA
ATATTTATGAGATACACACAGTTTTAGAAGGTGTCAGAACTATTCTCTAATTCTTCCTTA
AAATTAGAACTCTTGAAGAAATTGAATCTAGTAAAAAAGATCAAAGCGGTGGATTTGCTA
ACCTCATGAAAACTGTACTCACACTTGGTTTAGCTGGAAGTGGAAATGCTAATGACAAAG
ACAAAGATGGCAAAGTAAATAAATAATTTTTAAAAATTTACAAATTTTTTTTATTTTTTG
GTTTTCAGGAAGCATCTTCTTTTATATAACATCAAAAAAGAAAAAGATTATCAAGGAGAA
GCTACTTGGAGGCCGATTTATAATTAATAAGGCAATTAAAAATATAACTACAATTTCTAC
AATTATCATAAAAAATTACAAATTAATAAGAAGTAAATGAAAAATAAGCAATCAACTATC
ATGAGAAATCTTTCAATTTTTAGATTTTCTTTTAATTCCTTTTATTTCATCAAATACAAA
AAATATAAATTAAAACATATTTTTTTAATAAATGCTTTAAAAAATCAATCAATCTGAAAT
AAATATTAGAAAAATAAATAAACTTTATTTAAAGGATAGAAATTAATTTTTTAATTTTTT
CGAAAATTAGGCATTCTTTGAGAAATATCCTGATACTTGTAAGAGTTTGCTATATGATAT
CAAGTAAGTCGTTGAATTGTTTATTAACAGTTGGCAAACAACTCCAGAATTTATTACTGA
ATTCACAAGTTATGGTATCAGACCTTATGAACAAAAGAAATTCAACTCATTTAATAATTT
ATTGATGGACATGATCAAAAATGCTGAGAATGATAAACAGAGAGTTAAAATTTTAATTAT
TTCTATTATCAAACCTTTGGTATATGAATTCCCTAACGATATGATGAATTCCTTTTTACT
TTTATGGAACCGTAGCTGCATGACTGACCCACCAAATGCCCACAAGGATTTCAACTAAAA
CGAATTCTTAAAGAAAATGATAGAAATGATAACTATTTTAAATATTCCCAATGAACTTTT
CTTAGAATCATTCTATCAAAGCTTTATCAGTGAAATCATTCAAAAATTCTACCAACAAAA
GAACACTAAAGAAAAGAAAAATGTTTACTTCTTAAACTATGAAATTGCTCAACACGAGTC
TAAGCTCCTTTACTTCCTTTACATATATCTTTCATATACTTACATTGACAGCAATATTCT
TAAAAAAGAAAACCTTCTACTATTCTGGAACATTATCCTTAAAATCTTAAAAGTAATTTT
TATAAATATTAAAAATCATAATTTAACTTATTATTTTAAATAATGATAATAGATATTCTA
ACCCTCTAAAAATCCTAACACTGTGATGTGGATGCTTGATCTTTTGTACATGTTGAGTGA
AAAGTACTCTCCAAAGGAAATTTTATCAGATAGTAAGTTCAAGAAGGAATTGCACGATTT
GATAAATGAAAAGCTTTCTTACTTGTCTGGCTGGATTGCTAACGTTTACTAAGTCAAATT
TAACGAACCTTCTGCTTAAACTTAATAGTCTTTGAATAATGCAGTTGATTAACACATGAA
GGAAATGATTGTACAGAGCTTACAATAATATAGAATAATATCTCCTTACTCTCCTACTTT
TTACGAAATTAGTTTATCATTTTACAGTCAAATACACATTTTAGAGCATGCCCCTAAAAG
TATTGCTAACTAGATGAAGGAATTGTAGATGAATTAATTGGATCAATTCATCTTTGATCG
CATTGATACTGTTGACGAAAATGCTGTTTATGATAAATACAGATTAATTTGTTTGGAAAC
CCTCAAAACATTGTCTCTTGAGTTACTCTAAAATACTTACTCTCCAGAAAGATAGGACAG
AGTTGTCGTTCGTGTTAAGGAGTTTGTTGATCCCTTATATGCTGTTATTGAAAACAAAGG
AAGCACAAATTCTTACTTCCTTGAAAGTACTTCAGAGCTCATTTGTAGCTTGATCGAGAA
AGCTCCTTCTCTCTTGATTAAAGATTTCAGAAAAAGTATCTTAGAAATGTTTAACAAAGA
TAACTTCTTCTCTTGCAATAAGGGTACTTTGCGTTACTGGGGAAAAATTATAGATTATGT
TCTTACTCAAGATAAATCTAATGACCTTTTCAATGAATATCTTGAAAAAGTAAGTCTTTC
TGCTGGTTTCTTTGCTCGTGAATAGAATGAAAACAAAAAGAAAATAAAGGCTTTCAAAAG
AACTTGCTTTATCATCTTTTCAGGTGCCAAGGACAAATATGCCAATCGTTTACGTAAACT
TTTAGACAGTATCGCAGAAGTCATTAAAACAACTGATAGCTCTTAATCTTCTTTGCTTAT
ATTAATTCTTTTCTGCATTCGTATATTGATTCTTCGTCTATCTCAAAGCAACTTAAATGA
ACTCTTCAGACAAATCTGGCCCATTTTGCTTACATTGTTGATTCAAATATATTCAAAACC
ACTTCCTGGTCAACCTCCCCGTAATCCTAACTTGATGCTTGCTGGTTTGAAATTAATTGA
AATTCTCTCAGTTGCTCAACTAGATGAGTTCTTCTTGCATCAATGGATGTTTATTTTTGA
TTATTTCGGTCTTAAATTATAACCTTTGTCCTAATAAGAGCGTGAAAACCAAATCAGATT
AAGAGGCTAAATGAATGAAGCATAGCTAAGATAATATGCGAAAATATCTCCTTTCTACTT
CTAGCCTTTCGTTTCTACTTGTCTTAATGAGTAGGATTTAGGAGTTAAGTATGTAAATCA
ACCAATAGATGAATCAGAATAATCAGAATAAATTACATATCAAAAGAAACAACGTAAATT
AATTATGACTTAATGTAAAGTAGATGATGAAAATGAACTAAAGAGCCATGCTTTATCTCT
CTGTCAATATTTAATTTCAAATAACGAAAACCGTACAGAAATAGACTTTAACTCAATCGA
AGCCTTGATAGAGGATGACTTCATCAATTTAGATGAACACATTTTGAAGGTTTGA