Identifiers and Description

Gene Model Identifier

TTHERM_00773500

Standard Name

DNMT1 (DNA MethylTransferase 1)

Aliases

PreTt04441 | 128.m00119 | 3676.m00044

Description

Putative N6A DNA methyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00095 ) RNA methyltransferase, RsmD family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00773500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17669.11.9998298245723724e-130hypothetical protein (193 aa)
OxytrichaContig12765.0.g651.9999167998962255e-60Probable N6-adenine methyltran
sferase
Stentor CoeruleusSteCoe_38545.242885663363464e-22
SGDYGR001C0.000000000000020000882446601127YGR001C Putative protein of un
known function with similarity
to methyltransferase family m
embers; green fluorescent prot
ein (GFP)-fusion protein local
izes to the cytoplasm; require
d for replication of Brome mos
aic virus in S. cerevisiae
WormBaseWBGene000430570.000000000003998907168546896N(6)-adenine-specific DNA meth
yltransferase 2 homolog stat
us:Confirmed UniProt:Q5WRN3
protein_id:CAH60777.1
DictyBaseDDB_G02727080.000000000004997916451710233DDB_G0272708 on chromosome: 2
position 1910511 to 1911234

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00773500(coding)
ATGGACGCAGCTAAAAAAGTAAACAAATTCATAATGAAAAATCCAGAAAATGCTGACTTT
AATTAGTATTGGTATTCTCCAAAGACTATCGAAATCTTAGTCAATCAGGTCTTGAAGCAT
GGTAAAAACTGTGCTTTCTTATCAACTCCTAGTATATTTTATTCAATTAATGATGCTCAG
TTTTTGAAACAATGCTATGTTTTCGAGTTTGATAAAAAATTCGAGAAAAATAATCCTAAT
TTTGTTTTCTTTGATTTTCATAAACCTGAAGACATTCCTGCATAATTTCACAATTTTTTT
GACTTCATTGTAATTGATCCTCCTTTTATAACTCGCGATGTTTGGGAAAAGTATGCCAAT
GCAGCAAAAATAATTGGTAAAAAAGATGAAAATAATAAATTTGTAGCCAATGTATTGGCA
TCTTCAATCGATGAAAACGATAAAATGTTAGATGAATTGCTTGGCCTTAAAAAGAGAGTA
GCACGTCCTTTAATTCCTAATTTGGTTTACTAATATTCTTTATATTCAACATATGAAGAT
GAAAGCTTAAATTAAGTTAATGAAGAAATAGGATTTTGA


>TTHERM_00773500(protein)
MDAAKKVNKFIMKNPENADFNQYWYSPKTIEILVNQVLKHGKNCAFLSTPSIFYSINDAQ
FLKQCYVFEFDKKFEKNNPNFVFFDFHKPEDIPAQFHNFFDFIVIDPPFITRDVWEKYAN
AAKIIGKKDENNKFVANVLASSIDENDKMLDELLGLKKRVARPLIPNLVYQYSLYSTYED
ESLNQVNEEIGF


>TTHERM_00773500(gene)
ATGGACGCAGCTAAAAAAGTAAACAAATTCATAATGAAAAATCCAGAAAATGCTGACTTT
AATTAGTATTGGTATTCTCCAAAGACTATCGAAATCTTAGTCAATCAGGTCTTGAAGCAT
GGTAAAAACTGTGCTTTCTTATCAACTCCTAGTATATTTTATTCAATTAATGATGCTCAG
TTTTTGAAACAATGCTATGTTTTCGAGGTAACAATTTCTTAAACAACAAATATTAAATAA
AATTCAAAATTTATTAAAACCTAAATAAACAGTTTGATAAAAAATTCGAGAAAAATAATC
CTAATTTTGTTTTCTTTGATTTTCATAAACCTGAAGACATTCCTGCATAATTTCACAATT
TTTTTGACTTCATTGTAATTGATCCTCCTTTTATAACTCGCGATGTTTGGGAAAAGGTAA
TATTTAAAATTAATGTATTTAAAAAATGAGCTTAAAATAAAAATAGTATGCCAATGCAGC
AAAAATAATTGGTAAAAAAGATGAAAATAATAAATTTGTAGCCAATGTATTGGCATCTTC
AATCGATGAAAACGATAAAATGTTAGATGAATTGCTTGGCCTTAAAAAGAGAGTAGCACG
TCCTTTAATTCCTAATTTGGTTTACTAATATTCTTTATATTCAACATATGAAGATGAAAG
CTTAAATTAAGTTAATGAAGAAATAGGATTTTGA