Identifiers and Description

Gene Model Identifier

TTHERM_00585320

Standard Name

DNK1 (DeoxyNucleoside Kinase 1)

Aliases

PreTt04138 | 80.m00184 | 3675.m00082

Description

Deoxynucleoside kinase family protein; phosphorylates deoxynucleosides; localization shifts from the cytoplasm to mitochondria during conjugative growth

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

  • ( PF01712 ) Deoxynucleoside kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00585320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15175.19.995938456217754e-149deoxynucleoside kinase (233 aa
)
DictyBaseDDB_G02808430.0000000000499999055251093dgk on chromosome: 3 position
1424429 to 1425509

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000144

Sequences

>TTHERM_00585320(coding)
ATGATTGCTGAAAATAATAATAACAATTTCAACTTTTTGATTGAAGGTAATATCGGAGCT
GGTAAGTCTACTTTTGTTGATAAACTCAAATATCTTGAATTAGGCGCACCTATTAAGATC
GTCCCTGAACCAGTTAATATCTGGACTAACTATAATAACCACAACTACTTGTAATATTTT
TATGATAATCCTCGTAAGTGGACTTTTGCTTTCTAGCAAATGGTTTTAAACACTGCTGCT
AATGTCTATCGTGATAATCAATAAATGGATGTTAATACTACATAAATTAACTTTTTTGAG
CGTTCTATGTATTCACCAATCAATATATTTGCACTATAACAATATAAATCTAATGTTTTG
TGTGATGCTGAAATGGACTTAATTCGTAAAATCACCGATGACACTTGTAAATGGATTAAC
TATGACATTAAAGGTATTATTTATGTGCGTACTGACCCTTAAATAACTCGCGATCGTATG
GTAAAGAGAAATAGAAAAGAAGACTGTACCCTTCCTCTCGGATATCTATAAGATTTACAC
TAACTCCATGATGAATGGTTGATGGGCGACATGAAAAAAACTAATCTTCCAGTCCTTATA
TATGAAAATAATACAAATGTGACTATTGAAAATTTCGATAGAGTTAAATAAGAAATTTCT
TCTTGGGTACAAAATCCTACAGATAAGGTTATTAATCCTGAACTTTTTTGA


>TTHERM_00585320(protein)
MIAENNNNNFNFLIEGNIGAGKSTFVDKLKYLELGAPIKIVPEPVNIWTNYNNHNYLQYF
YDNPRKWTFAFQQMVLNTAANVYRDNQQMDVNTTQINFFERSMYSPINIFALQQYKSNVL
CDAEMDLIRKITDDTCKWINYDIKGIIYVRTDPQITRDRMVKRNRKEDCTLPLGYLQDLH
QLHDEWLMGDMKKTNLPVLIYENNTNVTIENFDRVKQEISSWVQNPTDKVINPELF


>TTHERM_00585320(gene)
ATGATTGCTGAAAATAATAATAACAATTTCAACTTTTTGATTGAAGGTAATATCGGAGCT
GGTAAGTCTACTTTTGTTGATAAACTCAAATATCTTGAATTAGGCGCACCTATTAAGATC
GTCCCTGAACCAGTTAATATCTGGACTAACTATAATAACCACAACTACTTGTAATATTTT
TATGATAATCCTCGTAAGTGGACTTTTGCTTTCTAGCAAATGGTTTTAAACACTGCTGCT
AATGTCTATCGTGATAATCAATAAATGGATGTTAATACTACATAAATTAACTTTTTTGAG
CGTTCTATGTATTCACCAATCAATATATTTGCACTATAACAATATAAATCTAATGTTTTG
TGTGATGCTGAAATGGACTTAATTCGTAAAATCACCGATGACACTTGTAAATGGATTAAC
TATGACATTAAAGGTATTATTTATGTGCGTACTGACCCTTAAATAACTCGCGATCGTATG
GTAAAGAGAAATAGAAAAGAAGACTGTACCCTTCCTCTCGGATATCTATAAGATTTACAC
TAACTCCATGATGAATGGTTGATGGGCGACATGAAAAAAACTAATCTTCCAGTCCTTATA
TATGAAAATAATACAAATGTGACTATTGAAAATTTCGATAGAGTTAAATAAGAAATTTCT
TCTTGGGTACAAAATCCTACAGATAAGGTTATTAATCCTGAACTTTTTTGA