Identifiers and Description

Gene Model Identifier

TTHERM_00136030

Standard Name

DNA2 (DNA replication ATP-dependent helicase)

Aliases

PreTt24328 | 10.m00377 | 3698.m00096

Description

Homolog of Saccharomyces DNA2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00580 ) UvrD/REP helicase
  • ( TIGR01612 ) rhoptry protein
  • ( TIGR00229 ) PAS domain S-box
  • ( TIGR01257 ) rim ABC transporter
  • ( TIGR00376 ) DNA helicase, putative
  • ( PF08696 ) DNA replication factor Dna2
  • ( TIGR00372 ) CRISPR-associated protein Cas4
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF03413 ) Peptidase propeptide and YPEB domain
  • ( TIGR00088 ) tRNA (guanine-N1)-methyltransferase
  • ( TIGR01447 ) exodeoxyribonuclease V, alpha subunit
  • ( PF04851 ) type III restriction enzyme, res
  • ( PF00418 ) Tau and MAP protein, tubulin-binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00136030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05769.12.000043494209831e-96hypothetical protein (288 aa)
OxytrichaContig16074.0.g1073.000745802558524e-63DNA replication factor Dna2
SGDYHR164C5.997098480211051e-62DNA2 Tripartite DNA replicatio
n factor with single-stranded
DNA-dependent ATPase, ATP-depe
ndent nuclease, and helicase a
ctivities; required for Okazak
i fragment processing; involve
d in DNA repair; cell-cycle de
pendent localization
DictyBaseDDB_G02747775.0020095550341075e-51DDB_G0274777 on chromosome: 2
position 3809416 to 3815083
WormBaseWBGene000010162.9990874792167046e-33locus:dna-2 status:Partially
_confirmed UniProt:Q9U3F2
protein_id:CAB54253.1
Stentor CoeruleusSteCoe_167200.000000000000004658886145103398

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00136030(coding)
ATGGATAATAATATGAACAGCTGGAAAAGATTAAACGAAAAAAATCAAGTAGATATAGAA
GATTATAATTAATTATAAAATATTTCAACTGTTCTTAGCAAAGAACCTAAAGCTAAAGTG
AAAGTTAGCTATAGTGAAAGCAGTAGCAGTGATGAAGATGATGATGAAAAATTTTTTATT
TAAAACTTTAGTCAAAAAATGTCTAATTCAACTTCTAAAAATTAAAATCAATCTGATCTT
TAGAAAAATAAGGCTGAATTAGAGACTAAAAAAATGATCAAAAGAGTAGAGAGTTTTTAA
GTTGAAAACTAGCAAACAAAAGATAATTAAGCTATGCATTAAAAAATGGAGTTAAGCTCT
TCTGATGATAGCGATGAAGATGTGGAGTTTATAACAAATCTTTAGAAAGCCTAGTAATAT
TAAAATTTGTTGAAGGAAATTAATGAGGAAAAGTATGTAAGCATAGTTATAACAGAAATT
ATAAAAAAAAATGAAATTCCTTAAGAATACTGGTAAGCCTTTAATCAAATTGCATGTGAT
GATCATGACTTAGCTGAAAAGGATATAAACAAAAATTATACATCAACATACTTAAGAGTA
AGTATTAAGAATAACAAATAACTTGAAGAAAAGTTAAAATTAGTAGAAATAGGTCTGTTG
TTAATAGGGAGTACTTATAATGATATAGAATATGATATAGATGATCAAGCTAACTTTTTG
GGAAAGTTTAATTATTAATTATTGAAGATGTAGAACTAAACAGATTAGCGCGATATACAT
CTTTTCTTCTCTATTTTACACTAGTTTTAGCTATGTGATAACAAGGAAAGAGTTATGAAG
GAGGTATTTTCAAGCTCAAACATCTTGATTATGGAGCCTGATCAGATGCTATATCCAACT
TTGATTGCTTAATCTACGTCTTGTTATAGGATACCTTTGATTAAAATGAAGTTTAAAGTT
ACTGAATCCACTAATTGGAATATGTTAAAGGGTGTTATATTGCATGACATATTCTAACAT
CTGATGACCTTGCATAGCTAAAATCAATAAATAAAAGAAATCATAAAAGAAAAATCAGAT
TCATTTTTAACAGACATAATCAAATAGCTTTACACTAAGTATTTAGAAGAGCTTTTTTTG
TTAGAAAAGTGCATTAACACTTTCGAAAAGGAAATCAAATATATAGCAAAAAATATGATG
GACTTTTTGTAAAATTATTTAATCGAAGGAAAACTTATAGAAACTAAGTATAGTAACAGA
AAAATTAAAATTAAAAAGCTAGTTGAAAATGAAATGGTTGTTAATAATGAGGCTCTAGGA
CTAAAAGGATAAATTGATTGTGTTTTCAAATGTGAAGTTGAAGAATAATTTTCTGATTAA
AAAGAAAAAAAATATGAATGTTTTCTTCCTTTTGAATTAAAAACAGGTGGAAAAAAAAAG
TAAATTTATGAAGATTAAAACCTGTTTTACTGTCTCTTATTAAATCAAAAATATGATCGT
AAATAAAATTTAGAGGGTTTTTTATACTATTTAAGTTTAAATGATCTCACTACATCATGT
CCCACTAAGTAATCTTCTGTGAATTTACTTACTAGAAGAAATAAACTTGCTAAATTTATA
AAGAATATGGAGACTCAAGGTAAAATGCCAGAAATAAATATTGAGAGACCTGATATTTGC
AAATTTTGCTATGAAAAAGAAGCATGCTATGCAAATCAATTAGTTGATGATTATGATAAT
ATTAAAGATATTGAAGATTTACCTGAAAAATATAAAATAGATAAATAATTTGAGTATTTT
CATTAATTTTATGATAGCTTAACGGAAGGATCGAAGCTTTATTTAAAAAAATGGATAGAT
CTAATTTAAATGGAATAATAATGTGATTCTGATATCAAAAAAGATAAAAAATAAAAGCTA
CTTAATGAGGCTGACAATCAGTTAATTTTTATGACTGAAAATTTCGATTAGTTTTTCTCT
TCTTAAGTTGAGTAGCTCTAAACAAGTGGCTATATCTAATCTTAGTAAAATCTTTCTTCT
AAAGATAGCTCTAGAGATAGTAATGCATCATAAAAAGAATATGAACATATTATTTATTTG
AGAAAAATATGTCCTTCGCTAAGTAAGCTTATTGCTTTAAGCGAATTTTACAAAGAAGGT
GAAAGCTTTGTGCTTTATTAGATGGACATAAAATGCAAATTCAAAGCTATTTTAGAAGAA
AAAACTCTTTAAGAGTAGAGTCACTCTATTATTTTAAAGCTTAAGAGCATACAAGCCCAG
GTTAACTTTGATAAAAAAAAGGTTGAAAAAGTTTTAAATAGTAAAATTGGTAACGGTCTA
TATTGGAGTTTAGAGAGCTATAACAAAGACTAATATCCAGATTAAAGATAGAATGTTTTA
AATTTGATTTTAAATAAACTTGTTATGCAAAGTGAAAGTCATTAGAAATTGAAAGAGGCT
TATAACTTAAAGTTGACCAATAAGGATTTTACATCTGTTATCATAGATAACTTTCCTCCT
AAATTTTAAAATAATGAATTTACTGATGAAAAGATAGAAGAAATTTTAAATAAATATCCA
AATCTTCTCAAAAATGTTGATTAAGCTGATTCTATTAAAAAAATTTTAAAAAGTGAATCA
CTCACATGCATCTTAGGTATGCCAGGAACTGGAAAGACATTTTTAATAGCTCATTTAATC
AAGATTTTAGCTGATTAAAAAAAGAAGGTCTTGGTCACAAGTTTTACTAATTCTGCACTT
GATAACATAATTGTTAAGTTATTAGAGATTTTCCCTGAGATAAAAAATATTTGCTTAAGA
AAAGGATCAAATAAAAATTTGATTCATTCAGTTGCTCAAGAAATTTTATATAATCCTTAC
TCCTTTGAGGAAGAAAGATAATTTTCTGACTACTTAAAAGAAAAATAGATATATTTTGCT
ACCATTATTGGCTCAAATAATAAATTATTTCACAGTGAAAAGATTAAATTTGACTATTGT
ATTATAGATGAAGCCTCCTAGTGTGTAGAGCCTCTTTGCTTAGGTCCTATGCTTATTTGT
GATAAATCTATTTTAATCGGAGATCATTTCTAGCTATAACCTCTAGTTAAAAATGAAGAA
GCTGGCAAATAAGGTCTTTCTATTAGTTTATTTGAAAGAATGTGTAATTAATATCCACTA
TGTTAAGTGAAGCTTAAAAGCCAATTCAGAATGAATAACAAAATTATGGAACTTTCAAAT
ATAATGGTGTATAATAATTAACTAAAGGCATTTGATGATAACATTGGTAATAGAAAAATT
AAAATTAATGAAGATGACTTAAAAAGGATAACAAACAAGAGTTTAAATCATTGTATGTAA
CCTAACAATGAGGTTGTTTTTATAGATACAAGCCTTTTGGAATAAAGCTTCAAAGTTGAA
GGAGCTGCTGAAGAAGATTTAGTTTAGAAATAATCAATTGAAGAAAATAGATTTTAGATT
AAGTTTATTTGTTTGCTGATTAAGAAATTTTAAGAAGTCAATATTTAAAATAAGAGCATG
GCTTTAATTACCCCTTACAACTTTTATAGAGTTCAATTCTTAAAAAATATGAACTAGCTT
CATATTGAATAAAATGACCTTGAACTCTTCACAGTTGACAAAAGTTAAGGAATAGATAAA
GATATTATAATTTTACATATATCTGATAAAATTGGAAATGATCACTTATTATCAAATTGG
AGAAGAACAAATGTTGCTATTACAAGATCAAAAATGAAATTAATCATCGTTGGAAATTAA
AATGTATTAAATCGCTATAAAACCATAGACACTTTAATGACTATACTCTAATAAAAGAAA
TATGTATACCAACTAACTCAACAAGAGATGCAAGAAATACAAGAAGAAGTTCTTTAATTA
TAAAATCCTGAAAATTGA


>TTHERM_00136030(protein)
MDNNMNSWKRLNEKNQVDIEDYNQLQNISTVLSKEPKAKVKVSYSESSSSDEDDDEKFFI
QNFSQKMSNSTSKNQNQSDLQKNKAELETKKMIKRVESFQVENQQTKDNQAMHQKMELSS
SDDSDEDVEFITNLQKAQQYQNLLKEINEEKYVSIVITEIIKKNEIPQEYWQAFNQIACD
DHDLAEKDINKNYTSTYLRVSIKNNKQLEEKLKLVEIGLLLIGSTYNDIEYDIDDQANFL
GKFNYQLLKMQNQTDQRDIHLFFSILHQFQLCDNKERVMKEVFSSSNILIMEPDQMLYPT
LIAQSTSCYRIPLIKMKFKVTESTNWNMLKGVILHDIFQHLMTLHSQNQQIKEIIKEKSD
SFLTDIIKQLYTKYLEELFLLEKCINTFEKEIKYIAKNMMDFLQNYLIEGKLIETKYSNR
KIKIKKLVENEMVVNNEALGLKGQIDCVFKCEVEEQFSDQKEKKYECFLPFELKTGGKKK
QIYEDQNLFYCLLLNQKYDRKQNLEGFLYYLSLNDLTTSCPTKQSSVNLLTRRNKLAKFI
KNMETQGKMPEINIERPDICKFCYEKEACYANQLVDDYDNIKDIEDLPEKYKIDKQFEYF
HQFYDSLTEGSKLYLKKWIDLIQMEQQCDSDIKKDKKQKLLNEADNQLIFMTENFDQFFS
SQVEQLQTSGYIQSQQNLSSKDSSRDSNASQKEYEHIIYLRKICPSLSKLIALSEFYKEG
ESFVLYQMDIKCKFKAILEEKTLQEQSHSIILKLKSIQAQVNFDKKKVEKVLNSKIGNGL
YWSLESYNKDQYPDQRQNVLNLILNKLVMQSESHQKLKEAYNLKLTNKDFTSVIIDNFPP
KFQNNEFTDEKIEEILNKYPNLLKNVDQADSIKKILKSESLTCILGMPGTGKTFLIAHLI
KILADQKKKVLVTSFTNSALDNIIVKLLEIFPEIKNICLRKGSNKNLIHSVAQEILYNPY
SFEEERQFSDYLKEKQIYFATIIGSNNKLFHSEKIKFDYCIIDEASQCVEPLCLGPMLIC
DKSILIGDHFQLQPLVKNEEAGKQGLSISLFERMCNQYPLCQVKLKSQFRMNNKIMELSN
IMVYNNQLKAFDDNIGNRKIKINEDDLKRITNKSLNHCMQPNNEVVFIDTSLLEQSFKVE
GAAEEDLVQKQSIEENRFQIKFICLLIKKFQEVNIQNKSMALITPYNFYRVQFLKNMNQL
HIEQNDLELFTVDKSQGIDKDIIILHISDKIGNDHLLSNWRRTNVAITRSKMKLIIVGNQ
NVLNRYKTIDTLMTILQQKKYVYQLTQQEMQEIQEEVLQLQNPEN


>TTHERM_00136030(gene)
ATGGATAATAATATGAACAGCTGGAAAAGATTAAACGAAAAAAATCAAGTAGATATAGAA
GATTATAATTAATTATAAAATATTTCAACTGTTCTTAGCAAAGAACCTAAAGCTAAAGTG
AAAGTTAGCTATAGTGAAAGCAGTAGCAGTGATGAAGATGATGATGAAAAATTTTTTATT
TAAAACTTTAGTCAAAAAATGTCTAATTCAACTTCTAAAAATTAAAATCAATCTGATCTT
TAGAAAAATAAGGCTGAATTAGAGACTAAAAAAATGATCAAAAGAGTAGAGAGTTTTTAA
GTTGAAAACTAGCAAACAAAAGATAATTAAGCTATGCATTAAAAAATGGAGTTAAGCTCT
TCTGATGATAGCGATGAAGATGTGGAGTTTATAACAAATCTTTAGAAAGCCTAGTAATAT
TAAAATTTGTTGAAGGAAATTAATGAGGAAAAGTATGTAAGCATAGTTATAACAGAAATT
ATAAAAAAAAATGAAATTCCTTAAGAATACTGGTAAGCCTTTAATCAAATTGCATGTGAT
GATCATGACTTAGCTGAAAAGGATATAAACAAAAATTATACATCAACATACTTAAGAGTA
AGTATTAAGAATAACAAATAACTTGAAGAAAAGTTAAAATTAGTAGAAATAGGTCTGTTG
TTAATAGGGAGTACTTATAATGATATAGAATATGATATAGATGATCAAGCTAACTTTTTG
GGAAAGTTTAATTATTAATTATTGAAGATGTAGAACTAAACAGATTAGCGCGATATACAT
CTTTTCTTCTCTATTTTACACTAGTTTTAGCTATGTGATAACAAGGAAAGAGTTATGAAG
GAGGTATTTTCAAGCTCAAACATCTTGATTATGGAGCCTGATCAGATGCTATATCCAACT
TTGATTGCTTAATCTAGTAATGTTTATTTTTACATTTATTTCTTTTTTTAAAGATGATAA
ATTAAATAGTTTTTTTATTTTAAATTTTAATTATAGCGTCTTGTTATAGGATACCTTTGA
TTAAAATGAAGTTTAAAGTTACTGAATCCACTAATTGGAATATGTTAAAGGGTGTTATAT
TGCATGACATATTCTAACATCTGATGACCTTGCATAGCTAAAATCAATAAATAAAAGAAA
TCATAAAAGAAAAATCAGATTCATTTTTAACAGACATAATCAAATAGCTTTACACTAAGT
ATTTAGAAGAGCTTTTTTTGTTAGAAAAGTGCATTAACACTTTCGAAAAGGAAATCAAAT
ATATAGCAAAAAATATGATGGACTTTTTGTAAAATTATTTAAGTAATTATTAATTGCATC
TCTCTGTTTTAAATTAAATATTTATTTTTTAAAGTCGAAGGAAAACTTATAGAAACTAAG
TATAGTAACAGAAAAATTAAAATTAAAAAGCTAGTTGAAAATGAAATGGTTGTTAATAAT
GAGGCTCTAGGACTAAAAGGATAAATTGATTGTGTTTTCAAATGTGAAGTTGAAGAATAA
TTTTCTGATTAAAAAGAAAAAAAATATGAATGTTTTCTTCCTTTTGAATTAAAAACAGGT
GGAAAAAAAAAGTAAATTTATGAAGATTAAAACCTGTTTTACTGTCTCTTATTAAATCAA
AAATATGATCGTAAATAAAATTTAGAGGGTTTTTTATACTATTTAAGTTTAAATGATCTC
ACTACATCATGTCCCACTAAGTAATCTTCTGTGAATTTACTTACTAGAAGAAATAAAGTA
CATTTATTTTTAATTTACTTAAACCATAAATAAATATTTACTTATTTATTTATTATTTAT
TTTTAATATTTACTGTAATTCCTCATTTATAAAAAAATCTTTTAACTTATTATACCAAAA
AATTGCTTTTTTTTAATAATTAAATTTTTGTTGAAAATTTCAAGACTAATTTGAACTAAT
TAAAAATAATTGTATTATGTATTTATTTCAGCGATATTTATATTTAAAAAAAGCTTGCTA
AATTTATAAAGAATATGGAGACTCAAGGTAAAATGCCAGAAATAAATATTGAGAGACCTG
ATATTTGCAAATTTTGCTATGAAAAAGAAGCATGCTATGCAAATCAATTAGTTGATGATT
ATGATAATATTAAAGATATTGAAGATTTACCTGAAAAATATAAAATAGATAAATAATTTG
AGTATTTTCATTAATTTTATGATAGCTTAACGGAAGGATCGAAGCTTTATTTAAAAAAAT
GGATAGATCTAATTTAAATGGAATAATAATGTGATTCTGATATCAAAAAAGATAAAAAAT
AAAAGCTACTTAATGAGGCTGACAATCAGTTAATTTTTATGACTGAAAATTTCGATTAGT
TTTTCTCTTCTTAAGTTGAGTAGCTCTAAACAAGTGGCTATATCTAATCTTAGTAAAATC
TTTCTTCTAAAGATAGCTCTAGAGATAGTAATGCATCATAAAAAGAATATGAACATATTA
TTTATTTGAGAAAAATATGTCCTTCGCTAAGTAAGCTTATTGCTTTAAGCGAATTTTACA
AAGAAGGTGAAAGCTTTGTGCTTTATTAGATGGACATAAAATGCAAATTCAAAGCTATTT
TAGAAGAAAAAACTCTTTAAGAGTAGAGTCACTCTATTATTTTAAAGCTTAAGAGCATAC
AAGCCCAGGTTAACTTTGATAAAAAAAAGGTTGAAAAAGTTTTAAATAGTAAAATTGGTA
ACGGTCTATATTGGAGTTTAGAGAGCTATAACAAAGACTAATATCCAGATTAAAGATAGA
ATGTTTTAAATTTGATTTTAAATAAACTTGTTATGCAAAGTGAAAGTCATTAGAAATTGA
AAGAGGCTTATAACTTAAAGTTGACCAATAAGGATTTTACATCTGTTATCATAGATAACT
TTCCTCCTAAATTTTAAGTAAATCTTTTGAGATTAAAAATAAATTTAATATTTTTTTAAA
AAAGAATAATGAATTTACTGATGAAAAGATAGAAGAAATTTTAAATAAATATCCAAATCT
TCTCAAAAATGTTGATTAAGCTGATTCTAGTATGGTTATTTATTTTATTTAGTAAAAACG
AATAATTTAACAATTGTTTAATCATTAATAATAAAAAGTTAAAAAAATTTTAAAAAGTGA
ATCACTCACATGCATCTTAGGTATGCCAGGAACTGGAAAGACATTTTTAATAGCTCATTT
AATCAAGATTTTAGCTGATTAAAAAAAGAAGGTCTTGGTCACAAGTTTTACTAATTCTGC
ACTTGATAACATAATTGTTAAGTTATTAGAGATTTTCCCTGAGATAAAAAATATTTGCTT
AAGAAAAGGATCAAATAAAAATTTGATTCATTCAGTTGCTCAAGAAATTTTATATAATCC
TTACTCCTTTGAGGAAGAAAGATAATTTTCTGACTACTTAAAAGAAAAATAGATATATTT
TGCTACCATTATTGGCTCAAATAATAAATTATTTCGTAAGTTTTCACATTAAAAATATAT
TTTTAAAATCTCATTATTTTATAGACAGTGAAAAGATTAAATTTGACTATTGTATTATAG
ATGAAGCCTCCTAGTGTGTAGAGCCTCTTTGCTTAGGTCCTATGCTTATTTGTGATAAAT
CTATTTTAATCGGAGATCATTTCTAGGTACTGAATAAAAATATAGTTAAATATAATATTC
AACTTATTAATATAAAAAGCTATAACCTCTAGTTAAAAATGAAGAAGCTGGCAAATAAGG
TCTTTCTATTAGTTTATTTGAAAGAATGTGTAATTAATATCCACTATGTTAAGTGAAGCT
TAAAAGCCAAGTAAATAAATAAATATTTTTTTAATTATGGTATTATGACATTATTGATTA
AATTAATAAATAGTTCAGAATGAATAACAAAATTATGGAACTTTCAAATATAATGGTGTA
TAATAATTAACTAAAGGCATTTGATGATAACATTGGTAATAGAAAAATTAAAATTAATGA
AGATGACTTAAAAAGGATAACAAACAAGAGTTTAAATCATTGTATGTAACCTAACAATGA
GGTTGTTTTTATAGATACAAGCCTTTTGGAATAAAGCTTCAAAGTTGAAGGAGCTGCTGA
AGAAGATTTAGTTTAGAAATAATCAATTGAAGAAAATAGATTTTAGATTAAGTTTATTTG
TTTGCTGATTAAGAAATTTTAAGAAGTCAATATTTAAAATAAGAGCATGGCTTTAATTAC
CCCTTACAACTTTTATAGAGTTCAATTCTTAAAAAATATGAACTAGCTTCATATTGAAGT
AAAACATAATTATTTCCATACAACTTTAATAGAATTTTAACTAAATAACATTAAAAGTAA
AATGACCTTGAACTCTTCACAGTTGACAAAAGTTAAGGAATAGATAAAGATATTATAATT
TTACATATATCTGATAAAATTGGAAATGATCACTTATTATCAGTAATATTTTTAAACAAA
AATTATATTCTAAATTTCATTTACCAATAGAATTGGAGAAGAACAAATGTTGCTATTACA
AGATCAAAAATGAAATTAATCATCGTTGGAAATTAAAATGTATTAAATCGCTATAAAACC
ATAGACACTTTAATGACTATACTCTAATAAAAGAAATATGTAATGAAATTTTAAGAATTT
GTTTATTAATAATTCCTTTGATTATTAAAACAGGTATACCAACTAACTCAACAAGAGATG
CAAGAAATACAAGAAGAAGTTCTTTAATTATAAAATCCTGAAAATTGA