Identifiers and Description

Gene Model Identifier

TTHERM_00459230

Standard Name

DMC1 (DMC1 homolog)

Aliases

PreTt20354 | 53.m00256 | 3712.m00114

Description

meiosis-specific RecA homolog

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00459230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13810.15.999773492405769e-126hypothetical protein (252 aa)
OxytrichaContig4225.0.0.g497.000620174165717e-94Rad51
DictyBaseDDB_G02736118.003693242657371e-87rad51-2 on chromosome: 2 posit
ion 3169189 to 3170422
SGDYER179W9.99562814099401e-84DMC1 Meiosis-specific protein
required for repair of double-
strand breaks and pairing betw
een homologous chromosomes; ho
molog of Rad51p and the bacter
ial RecA protein
WormBaseWBGene000042971.0002223712504345e-79locus:rad-51 status:Confirme
d UniProt:G5EGG8 protein_i
d:CAE47473.1
Stentor CoeruleusSteCoe_174667.47197233734299e-43

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21483758: Howard-Till RA, Lukaszewicz A, Loidl J (2011) The recombinases Rad51 and Dmc1 play distinct roles in DNA break repair and recombination partner choice in the meiosis of Tetrahymena. PLoS genetics 7(3):e1001359

Sequences

>TTHERM_00459230(coding)
ATGAACGATTGTTACTCTGATAAAGAAGATAATGAAGAATAAAACTAAATTGCTCAAGAA
GAGATCTTTTTAGTAGAAATGCTTGCAACTGAGGGAGTTAACAATAATGAAATACAAAAG
CTTAAAAAGAATGGAATCCTTTCACTCAAATCTTTAGTTATGAACACAAAGAGGGATCTT
GTTAATATCTATGGAATTCCTGATAATAAAGCTGATTCATATGTCAAAAAAGCTTCAGAA
ATATTAGCTCGATCTGAAAACAGCAGGTTATTCAGCAGTGAGTTTGTTCTCGGTACTACT
GTACTATAAAGAAGGAGTTAAATAAGAAGAATATCAACAGGATCCAAGGCTTTAGATGAT
ATATTGAATGGGGGAATAGAGTCTCAAAGCATAACAGAATTTTATGGAGAATATCGTTCA
GGCAAAACATAAATAGCTCATACTGCATGCGTTCTGGCTCAATCTTAAGATCATTGCTAA
AGTCCAGGAAAAGTTTTATACATTGATACTGAAGGAACCTTCAGACCTGAAAGAATATGC
TAAATAGCTTCGCACTACGGAATGGAGGGTGAATATGCCCTAAGTAATATAATTTATGGG
AGAGCCTATAACGTAGATTAATAAAACACATTGCTTATTAAAGGAGCCCAATTAATGGTA
GAGGAAAATTGTTTTGCTCTACTAGTTGTTGATTCAATAATGGCTAATTTTAGATGCGAT
TTTTCTGGAAGAGGAGATCTCTCTGAAAGACAATAAGCACTTGGCAAGTTTATGAGCAGA
TTATAAAGAATGGCTGCTGAATTTAATATCGCAGTGATTATAACAAACTAAGTTATGGCT
GATCCAAGTGGAGCCATGACTGGAGGCGCTATACCCTAGCCCAAGCCAATTGGAGGCCAT
ATTTTAGCCCATGCATCGACATAGCGCTTATTCATGAAGAAGAAAACTGATAACATCCGT
AAAGTAAAGCTGGTTGATTCACCTTATTTGTAAGATAAAGAAGTTGATATTATGGTTAGC
GACAGAGGAGTAGGAGATGTTGAATGTGATAAAAAGCCTTCTACTGGTTGA


>TTHERM_00459230(protein)
MNDCYSDKEDNEEQNQIAQEEIFLVEMLATEGVNNNEIQKLKKNGILSLKSLVMNTKRDL
VNIYGIPDNKADSYVKKASEILARSENSRLFSSEFVLGTTVLQRRSQIRRISTGSKALDD
ILNGGIESQSITEFYGEYRSGKTQIAHTACVLAQSQDHCQSPGKVLYIDTEGTFRPERIC
QIASHYGMEGEYALSNIIYGRAYNVDQQNTLLIKGAQLMVEENCFALLVVDSIMANFRCD
FSGRGDLSERQQALGKFMSRLQRMAAEFNIAVIITNQVMADPSGAMTGGAIPQPKPIGGH
ILAHASTQRLFMKKKTDNIRKVKLVDSPYLQDKEVDIMVSDRGVGDVECDKKPSTG


>TTHERM_00459230(gene)
ATGAACGATTGTTACTCTGATAAAGAAGATAATGAAGAATAAAACTAAATTGCTCAAGAA
GAGATCTTTTTAGTAGAAATGCTTGCAACTGAGGGAGTTAACAATAATGAAATACAAAAG
CTTAAAAAGGTATGTAGTTGTTATATTAATTCACAATAAGACAATATCATTGATTATATA
AAAATAAATATAAAGAATGGAATCCTTTCACTCAAATCTTTAGTTATGAACACAAAGAGG
GATCTTGTTAATATCTATGGAATTCCTGATAATAAAGCTGATTCATATGTCAAAAAAGCT
TCAGAAATATTAGCTCGATCTGAAAACAGCAGGTTATTCAGCAGTGAGTTTGTTCTCGGT
ACTACTGTACTATAAAGAAGGAGTTAAATAAGAAGAATATCAACAGGATCCAAGGCTTTA
GATGATATATTGAATGGGGGAATAGAGTCTCAAAGCATAACAGAATTTTATGGAGAATAT
CGTTCAGGCAAAACATAAATAGCTCATACTGCATGCGTTCTGGCTCAATCTTAAGATCAT
TGCTAAAGTAAAACAAGCATAAGAAATTTTAACTGGTTTTAAATAAATTATTCTGCTTAA
ATATAGCCATTTAAATAAAAAAATAGGTCCAGGAAAAGTTTTATACATTGATACTGAAGG
AACCTTCAGACCTGAAAGAATATGCTAAATAGCTTCGCACTACGGAATGGAGGGTGAATA
TGCCCTAAGTAATATAATTTATGGGAGAGCCTATAACGTAGATTAATAAAACACATTGCT
TATTAAAGGAGCCCAATTAATGGTAGAGGAAAATTGTTTTGCTCTACTAGTTGTTGATTC
AATAATGGCTAATTTTAGATGCGATTTTTCTGGAAGAGGAGATCTCTCTGAAAGACAATA
AGCACTTGGCAAGTTTATGAGCAGATTATAAAGAATGGCTGCTGAATTTAATATCGCAGT
GGTAAATAAATACATTCTTTATTTTATCAACACCTTTCTGCTTTTATACGATTCTTATTC
TTAAAATTAACAAACAGATTATAACAAACTAAGTTATGGCTGATCCAAGTGGAGCCATGA
CTGGAGGCGCTATACCCTAGCCCAAGCCAATTGGAGGCCATATTTTAGCCCATGCATCGA
CATAGCGCTTATTCATGAAGAAGAAAACTGATAACATCCGTAAAGTAAAGTAAAACAAAA
CAAAACTTCTTAAATCACAAATAAAAAATTTTTCTTTCACTTAATTAAAGGCTGGTTGAT
TCACCTTATTTGTAAGATAAAGAAGTTGATATTATGGTTAGCGACAGAGGAGTAGGAGAT
GTTGAATGTGATAAAAAGCCTTCTACTGGTTGA