Identifiers and Description

Gene Model Identifier

TTHERM_00357110

Standard Name

DMAP1 (DNA-Methyltransferse-1-Associated Protein)

Aliases

PreTt27597 | 37.m00314 | 3836.m02399

Description

DNA-Methyltransferse-1-Associated Protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01290 ) Thymosin beta-4 family
  • ( PF00249 ) Myb-like DNA-binding domain
  • ( PF05499 ) DNA methyltransferase 1-associated protein 1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00357110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02229.19.997093137033517e-262hypothetical protein (401 aa)
WormBaseWBGene000136769.997975313387782e-28locus:ekl-4 status:Confirmed
UniProt:Q8WQA7 protein_id
:CAD21666.1
DictyBaseDDB_G02887472.999534586690157e-23DDB_G0288747 on chromosome: 5
position 1912921 to 1916049
SGDYGR002C6.002144168983342e-19SWC4 Component of the Swr1p co
mplex that incorporates Htz1p
into chromatin; component of t
he NuA4 histone acetyltransfer
ase complex
OxytrichaContig21896.0.g79.997764199084386e-16hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000280
  2. Ref:SUPR000321

Sequences

>TTHERM_00357110(coding)
ATGTCTGAAGGTCTTTAAAAGTTAGTCATGTTTTTTTCTGATTAAGGGAAGAAAAAGAAG
CGCTTGATTGATAATAAAAAGAAAAATATTGAATATGCAGACAAAGAAGTTTGGAATATT
ACAGGTGGATTGTTCCCTCTTATTCCTACTAGCAATAATAAATCAAAAGATGAACCTGTT
CGTTAGTGGTCTTATAGCCCTATAGTTTAAAAAACTTAATAAATTTCATCTATTTTACAT
TGGGTGCCTGTAACAGACAAAGATAAACTATTTTCTTGTGAGAAATTTAACATTAAAATA
GATTTAGTTGATTTTAATGAAGAACAATACAACGAATATTTAAAGGAATTAGACTCAAGT
TGGGATTATGAGGAAACAAAATACCTCTGGGATTTATGCTAAAGATTTGATTTAAGATTT
ATTATTATTGCTGACAGATACGATGAAAAGAGATGTAGAAGCATTGAAGATATTAAACAG
AGATTCTACTCTGTCACTCGTAGACTGTTAGAAGTTAGAAATCAGCAAAATCACCCTTTA
TATAATTATAAATATGACCCTGAATATGAAAGAGTCAGAAAATTCGAATTAGAAAAGTTT
TTAATGAGAACAAAAGAAACAACAGAACAAGAGAAGAATTTATTGGATAGTTTAAAAAGG
ATAGAGGTTTAGATTAAAAAGGAAGAAAGAGAACATCAAACTCTCTAAAAAATGTTAAAG
GAATAAATGAATGATGACAATGATATTGACAATGAAGAAGACTGTGTTAAGATCGTTTAA
ACAATCCACGAATAAGGTAAAAAGGAGATCAGCAATCCAACTGAAAGTATTTGTTACTTG
AGAGGTAAATGGTTGAATGAGCCACTACCTATTTCTGAAAAAATGAACAAAAAGCTTTCT
CTCGTTCTTAGTGAATTGTGTATCCCTAGTGACTTTATTGCCACTGAAGAAAACGAATAA
ATATTTGAAGAATTGAGAGAATAAATTTTCAACATGTTTAACATATAAAAATCTTTAAAA
AAGAAGGAAATGATAAAAAAGCAATTAGAAGACAAAAAGAGAAAATTAATGGAAGATCTT
AATATTTAAGACAAAGCACCTTCTAGTCCAACATCCTCCTAATAAAAGAGACCAAATCCT
TATGTTCAAGAGACATAAAATTTAGAAAAAGTTAATAAAAAAGTCAAATCTTAAAACTGA


>TTHERM_00357110(protein)
MSEGLQKLVMFFSDQGKKKKRLIDNKKKNIEYADKEVWNITGGLFPLIPTSNNKSKDEPV
RQWSYSPIVQKTQQISSILHWVPVTDKDKLFSCEKFNIKIDLVDFNEEQYNEYLKELDSS
WDYEETKYLWDLCQRFDLRFIIIADRYDEKRCRSIEDIKQRFYSVTRRLLEVRNQQNHPL
YNYKYDPEYERVRKFELEKFLMRTKETTEQEKNLLDSLKRIEVQIKKEEREHQTLQKMLK
EQMNDDNDIDNEEDCVKIVQTIHEQGKKEISNPTESICYLRGKWLNEPLPISEKMNKKLS
LVLSELCIPSDFIATEENEQIFEELREQIFNMFNIQKSLKKKEMIKKQLEDKKRKLMEDL
NIQDKAPSSPTSSQQKRPNPYVQETQNLEKVNKKVKSQN


>TTHERM_00357110(gene)
ATGTCTGAAGGTCTTTAAAAGTTAGTCATGTTTTTTTCTGATTAAGGGAAGAAAAAGAAG
CGCTTGATTGATAATAAAAAGAAAAATATTGGTGATTATTTTACTTATTTTTTAAATAAA
TACAATAAATAATTTCAAGCAAAATATAAAGCTGCCATTCATAAAATTTGCATATTAACC
TTACAAATATAATAAATTATTATTAGAATATGCAGACAAAGAAGTTTGGAATATTACAGG
TGGATTGTTCCCTCTTATTCCTACTAGCAATGTAAGATTTTATTATTTTAGCTTTTGTTT
AATAAATATTAATTTATAAAGAATAAATCAAAAGATGAACCTGTTCGTTAGTGGTCTTAT
AGCCCTATAGTTTAAAAAACTTAATAAATTTCATCTATTTTACATTGGGTGCCTGTAACA
GACAAAGATAAACTATTTTCTTGTGAGAAATTTAACATTAAAATAGATTTAGTTGATTTT
AATGAAGAACAATACAACGAATATTTAAAGGTATAGTTAGGAAATTTATTTATTATCTTT
AAATAATAAAGCTTTTTTAATTACAAGCAAATTCAAATTATTTATGCTTACAATAAAATC
AAAACAAAAGGAATTAGACTCAAGTTGGGATTATGAGGAAACAAAATACCTCTGGGATTT
ATGCTAAAGATTTGATTTAAGATTTATTATTATTGCTGACAGATACGATGAAAAGAGATG
TAGAAGCATTGAAGATATTAAACAGAGATTCTACTCTGTCACTCGTAGACTGTTAGAAGT
TAGAAATCAGCAAAATCACCCTTTATATAATTATAAATATGACCCTGAATATGAAAGAGT
CAGAAAATTCGAATTAGAAAAGTTTTTAATGAGAACAAAAGAAACAACAGAACAAGAGAA
GAATTTATTGGATAGTTTAAAAAGGATAGAGGTTTAGATTAAAAAGGAAGAAAGAGAACA
TCAAACTCTCTAAAAAATGTTAAAGGAATAAATGAATGATGACAATGTAAATTCATTTCT
ATTTGAATAGCAAAATATTTTATTTTTATGTTTTAAATATTACCAGGATATTGACAATGA
AGAAGACTGTGTTAAGATCGTTTAAACAGTAAAATATATATTAAGTTTATTGACAAATAT
TTTGAAAATTAACTAAAATAAATAGATCCACGAATAAGGTAAAAAGGAGATCAGCAATCC
AACTGAAAGTATTTGTTACTTGAGAGGTAAATGGTTGAATGAGCCACTACCTATTTCTGA
AAAAATGAACAAAAAGGTATTTGATATATTTTTATTATAAAAATTTAATAATAAAGACTT
TAACAATATTTTCAATATAAAATAGCTTTCTCTCGTTCTTAGTGAATTGTGTATCCCTAG
TGACTTTATTGCCACTGAAGAAAACGAATAAATATTTGAAGAATTGAGAGAATAAATTTT
CAACATGTTTAACATATAAAAATCTTTAAAAAAGAAGGAAATGGTAATTAATTAATTAAA
TATAAATTTATCTATTTTCTGACTGAAAAAATATTTTTTTAAAAAGATAAAAAAGCAATT
AGAAGACAAAAAGAGAAAATTAATGGAAGATCTTAATATTTAAGACAAAGCACCTTCTAG
TCCAACATCCTCCTAATAAAAGAGACCAAATCCTTATGTTCAAGAGACATAAAATTTAGA
AAAAGTTAATAAAAAAGTCAAATCTTAAAACTGA