Identifiers and Description

Gene Model Identifier

TTHERM_00449029

Standard Name

DLC82 (Dynein Light Chain)

Aliases

3811.m00956

Description

Dynein Light Chain 8B

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00449029

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14979.11.9990871925214856e-61hypothetical protein (93 aa)
OxytrichaContig20780.0.g1062.0008113830639685e-30Dynein light chain type 1
WormBaseWBGene000010056.997498932278805e-30locus:dlc-1 Dynein light cha
in 1, cytoplasmic status:Con
firmed UniProt:Q22799 prot
ein_id:CCD63216.1
SGDYDR424C2.000620012690291e-23DYN2 Cytoplasmic light chain d
ynein, microtubule motor prote
in; proposed to be involved in
the assembly of the nuclear p
ore complex
DictyBaseDDB_G02748151.0002869940498747e-21dlcB on chromosome: 2 position
3974977 to 3975525
Stentor CoeruleusSteCoe_368010.000000000000012664165549094176

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00449029(protein)
MSHLDKVQPVIKNSDMSVEMQKEVEEVAKKAIDYCNTDKEIATFIKDDFRSRYHGTWHCI
VGRNFGSFVTFERSYYIYLYVGQLAILLFKTG


>TTHERM_00449029(coding)
ATGAGTCATTTGGATAAAGTTTAACCAGTTATTAAGAACTCTGATATGAGTGTTGAAATG
TAGAAGGAAGTTGAAGAAGTAGCTAAAAAAGCTATCGATTACTGTAACACTGATAAAGAA
ATAGCCACATTTATTAAGGATGATTTTAGATCTCGTTATCATGGAACTTGGCATTGTATT
GTTGGCAGAAACTTTGGAAGTTTCGTCACTTTTGAGCGTAGTTACTATATTTATCTTTAT
GTTGGATAGCTCGCTATTTTGCTTTTCAAAACCGGTTGA


>TTHERM_00449029(gene)
ATGAGTCATTTGGATAAAGTTTAACCAGTTATTAAGAACTCTGATATGAGTGTTGAAATG
TAGAAGGAAGTTGAAGAAGTAGCTAAAAAAGCTATCGATTACTGTAACACTGATAAAGAA
ATAGCCACATTTATTAAGGATGATTTTAGATCTCGTTATCATGGAACTTGGCATTGTATT
GTTGGCAGAAACTTTGGAAGTTTCGTCACTTTTGAGCGTAGTTACTATATTTATCTTTAT
GTTGGATAGCTCGCTATTTTGCTTTTCAAAACCGGTTGA