Identifiers and Description

Gene Model Identifier

TTHERM_00047440

Standard Name

DIS32 (Exosome complex exonuclease DIS3-2)

Aliases

PreTt11223 | 3.m01807 | 3824.m02982

Description

RNB-like protein; associated with cytoplasmic exosome

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00047440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_210770
WormBaseWBGene000010019.997093137033517e-262locus:dis-3 Probable exosome
complex exonuclease RRP44 s
tatus:Partially_confirmed Un
iProt:Q17632 protein_id:CAA9
4677.2
Tetrahymena borealisEI9_01706.19.997093137033517e-262RNB-like protein (947 aa)
DictyBaseDDB_G02936149.997093137033517e-262DDB_G0293614 on chromosome: 6
position 3144728 to 3147821
OxytrichaContig19321.0.g579.997093137033517e-262RNB domain
SGDYOL021C9.997093137033517e-262DIS3 Exosome core complex cata
lytic subunit; possesses both
endonuclease and 3-5 exonuclea
se activity; involved in 3-5 R
NA processing and degradation
in both the nucleus and the cy
toplasm; has similarity to E.
coli RNase R and to human DIS3

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000278

Sequences

>TTHERM_00047440(coding)
ATGAACACATCAATTAGCGTTCAATTTGAGAAGTATAGAAGAGGAGGTATCGGCAAAAAG
GTCACTGAATTGTATTTAAGAGATGATATCTCATGTGGTTTAGTGAATTGCCAAATATGC
AAAACACCTGGAAATACTCTACATATTGAAGGAGAAGATAGAACAATTTTTATTTTAGAT
GAATATACCGTCTTAACTTAGTTAGATGTCATTCTTAATTGCCCAAAACTTGTGAATGTA
GTTTTAATGCAAACTACTGTGCACAACATTTAAAAAAAAAACCAAAACACATATACAAGC
TTGAGAAATTTAGTTGAGGGTGAAATTTATAGAAATATACATATATATGCTAACGAATAT
AGCAAATACACATACACTCCCATCCAATAAAATGAAAAGTAAGAAACAAGAGATACTCGT
GCAGTGCTTGAAGCAGCTGTTTGGTATTAAAATCATTTAAAGAGCAGTATGAGAGATATT
GAGATATTATTTATTACAAGCGATTACTAATCTCATAAAATTGCTTTGGAAAAAGGATTA
AACTCGACCACTATATTTGAGTTTGTTAAATCGATTAAAGGTGAATATCCTAATTTGATG
GATTTTTTGGGTATCTCAGAGTAGGCTATGGATATTGAATTTGAAGGATAATAGGTTCTA
TTCTAAGAACACCTTACTTTGAATGAATTGAGTAATAAGGTCAAAGCAGGTGACCTGTTC
TAAGGTAAACTTAAGATAGATAGAAACGATATTAATGATGGTACTGTATTTATCCCAAAA
TATGATTTTGAAATTAAGATCATTGGATAACCTAACTTAAATCGTGCTTTGCATGGAGAT
TTAATAGCTATAGAGCTTTTACCAGAGAACGAGTGGATATCATCAAATTATATGGGTGAT
AATGAAGACGAAGAAGAAGATTTCAAGAATGTGCATGAAGCTGTCAAAACAAACAATTCT
AATAAATAGTTAGAAGAAAAATATTTAAATGTAGTAGAAAAAATTAAAAAATTAAACTTA
AATCCTACTGGTAGAGTAGTCGGAGTTATAAAAAGAATCTAAAGATATTTCTGCGGAGAA
GTTACACCAGAAGCTATCAATTTACCAAATTTACCTAGTGGTATAGAACTTAGAGAATTT
ATTCCTGCAGATGGACGTTTCCCCCATTTCTACTTAAGAACCACAAATGGATCTCAATTA
TAAGGAAAAAAAATATAAATTGGTTTCGATAACTGGAGTAAATCTTCTAAATATCCTTTA
GGACATTTCAAGATGCTTATTGGTGATTCAGGAGATACTAAGGCTGAAGGAGATGTTATT
TTGCTAGAACACAACGTTGAATATAGAGCTTTTTCTAAGTAAGTTCTTGATTGTTTACCT
CCATAAGACGATAAATGGTAAATTCCATAATCAGAAATAAAAAAGAGAGTTGACTTAAGA
GGAATTAATGTCTGTAGTATTGATCCTCCTGGGTGTAAAGATATTGATGATGCTCTTCAC
TGTATATCTTTACCAAATGGTAATTTTGAAGTTGGTGTACATATTGCAGACGTAAGCTAT
TTTGTTCGTCCTGATACTGCTATTGACAAAGAAGCCTAAAATAGATGTACTACTGTCTAT
TTAGTAGATAGAAGAACAGATATGCTTCCAAAGCTTTTAACCGAAACACTCTGCTCTTTA
AAAGACGATGGTGACAGACTAGCATTTTCAGTTGTTTGGGTAATGGATAAAGATGCTAAC
ATTATTGAAACTCGCTATCATAAGTCAATAATCAGATCAGTTGCTTCTCTCAATTACGGT
AAAGCACAATCTATGATTGATGACGTTAATGACAATTCAGAGCTTACCAAATCTATAAGA
AATTTAAATATGCTTGCAAAGAAATTAAAGTAAAAAAGAATCGAAAACGGTGCCTTATCA
TTAGCTTCAACTTAAGTTAAATTCACATTTGATGATGAAACACATAATCCAGTTGATGTT
TAATTCTACCAAATGTATGAAACTAACTCTCTTATTGAAGAGTTTATGCTTCTTGGAAAT
GTTGCAGTTGCTGAAAAGATAGTATCTCACTTCCCTTCTATTTCTATTTTACGTTAGCAC
TCCTAGCCTAAACCTAAATAAATAAAAGAACTCTCATAAATTTTATAAAAGATTGGATTT
AATCTTGATTACTCTTCAAACAGGAATTTAGCAGATAGTTTGGATAAAGTAAACAGACCT
AATGATCATTTCTTTAATAAATTGGTTCGTATCATGACTACCAGATCCATGAATGAAGCC
ACATATTTTTGTACAGCTGATGCTGATTATCCTGAATTTTATCATTATGGTTTGGCTGCA
CCCCTTTATACTCACTTCACCTCTCCAATTCGTAGATATGCTGATGTTTTAGTTCACAGA
CTCCTTGCTGCCGCTATTGATATTGAAGCTATTCCAGCATATATGTCAAACAAGCTTAAA
ATGGCTAAAATTTGCGAAAAAATGAATATGAGAAATCGTATGGCTCGTTTTGCATCACGC
TCCAGCTCAGATTATAACACTTATTTATTTTTTAAAGATAAACAAATTGAAGAAGTTGCT
ATGGTATCAAGCATTAGTAAAACTGGTGCTACTGTTGTTGTTCCTCGTTATGGTTTAGAA
GGACAAATTAAATTTAGTGAAAAAGATTTAAAAGAAAACGAGAAATTGTTGCAAGAGCTC
AAACAAAATTAATCTTTAATAATTGATTTCGTTGTAAATGGAAACAGACATAAATTATTT
GATTACCTTAAAGTAAGAGTAAGTGTTGGCATGAAAAACTTTCATAAATAAATTACTTTA
GAATATTTAGGTCCTAACTGA


>TTHERM_00047440(protein)
MNTSISVQFEKYRRGGIGKKVTELYLRDDISCGLVNCQICKTPGNTLHIEGEDRTIFILD
EYTVLTQLDVILNCPKLVNVVLMQTTVHNIQKKNQNTYTSLRNLVEGEIYRNIHIYANEY
SKYTYTPIQQNEKQETRDTRAVLEAAVWYQNHLKSSMRDIEILFITSDYQSHKIALEKGL
NSTTIFEFVKSIKGEYPNLMDFLGISEQAMDIEFEGQQVLFQEHLTLNELSNKVKAGDLF
QGKLKIDRNDINDGTVFIPKYDFEIKIIGQPNLNRALHGDLIAIELLPENEWISSNYMGD
NEDEEEDFKNVHEAVKTNNSNKQLEEKYLNVVEKIKKLNLNPTGRVVGVIKRIQRYFCGE
VTPEAINLPNLPSGIELREFIPADGRFPHFYLRTTNGSQLQGKKIQIGFDNWSKSSKYPL
GHFKMLIGDSGDTKAEGDVILLEHNVEYRAFSKQVLDCLPPQDDKWQIPQSEIKKRVDLR
GINVCSIDPPGCKDIDDALHCISLPNGNFEVGVHIADVSYFVRPDTAIDKEAQNRCTTVY
LVDRRTDMLPKLLTETLCSLKDDGDRLAFSVVWVMDKDANIIETRYHKSIIRSVASLNYG
KAQSMIDDVNDNSELTKSIRNLNMLAKKLKQKRIENGALSLASTQVKFTFDDETHNPVDV
QFYQMYETNSLIEEFMLLGNVAVAEKIVSHFPSISILRQHSQPKPKQIKELSQILQKIGF
NLDYSSNRNLADSLDKVNRPNDHFFNKLVRIMTTRSMNEATYFCTADADYPEFYHYGLAA
PLYTHFTSPIRRYADVLVHRLLAAAIDIEAIPAYMSNKLKMAKICEKMNMRNRMARFASR
SSSDYNTYLFFKDKQIEEVAMVSSISKTGATVVVPRYGLEGQIKFSEKDLKENEKLLQEL
KQNQSLIIDFVVNGNRHKLFDYLKVRVSVGMKNFHKQITLEYLGPN


>TTHERM_00047440(gene)
ATGAACACATCAATTAGCGTTCAATTTGAGAAGTATAGAAGAGGAGGTATCGGCAAAAAG
GTCACTGAATTGTATTTAAGAGATGATATCTCATGTGGTTTAGTGAATTGCCAAATATGC
AAAACACCTGGTAGAATATTAGAAATAATATTTAGAATAATAATAACTATCGTAGAAATT
AACTAAAATTTAACTTTAATCCAACAGGAAATACTCTACATATTGAAGGAGAAGATAGAA
CAATTTTTATTTTAGATGAATATACCGTCTTAACTTAGTTAGATGTCATTCTTAATTGCC
CAAAACTTGTGAATGTAGTTTTAATGCAAACTACTGTGCACAACATTTAAAAAAAGTAAA
TAAAATACATTCAATAGGTATTTTAAAAATTAAAGTTTATTTTTAATAAATTTAGAAACC
AAAACACATATACAAGCTTGAGAAATTTAGTTGAGGGTGAAATTTATAGAAATATACATA
TATATGCTAACGAATATAGCAAATACACATACACTCCCATCCAATAAAATGAAAAGTAAG
AAACAAGAGATACTCGTGCAGTGCTTGAAGCAGCTGTTTGGTATTAAAATCATTTAAAGG
TAAAGACTTATATAAATAGTAATAGTTTATAATTGTTGATATAATAATATTTTCTATTTA
TAGAGCAGTATGAGAGATATTGAGATATTATTTATTACAAGCGATTACTAATCTCATAAA
ATTGCTTTGGAAAAAGGATTAAACTCGACCACTATATTTGAGTTTGTTAAATCGATTAAA
GGTGAATATCCTAATTTGATGGATTTTTTGGGTATCTCAGAGTAGGCTATGGATATTGAA
TTTGAAGGATAATAGGTTCTATTCTAAGAACACCTTACTTTGAATGAATTGAGTAATAAG
GTCAAAGCAGGTGACCTGTTCTAAGGTAAACTTAAGATAGATAGAAACGATATTAATGAT
GGTACTGTATTTATCCCAAAATATGATTTTGAAATTAAGATCATTGGATAACCTAACTTA
AATCGTGCTTTGCATGGAGATTTAATAGCTATAGAGCTTTTACCAGAGAACGGTAATTTA
CATGCCATTTATCTATCTACAAAAGATTTAAATATTTTTATTTTAATTTATTAAAGAGTG
GATATCATCAAATTATATGGGTGATAATGAAGACGAAGAAGAAGATTTCAAGAATGTGCA
TGAAGCTGTCAAAACAAACAATTCTAATAAATAGTTAGAAGAAAAATATTTAAATGTAGT
AGAAAAAATTAAAAAATTAAACTTAAATCCTACTGGTAGAGTAGTCGGAGTTATAAAAAG
AATCTAAAGATATTTCTGCGGAGAAGTTACACCAGAAGCTATCAATTTACCAAATTTACC
TAGTGGTATAGAACTTAGAGAATTTATTCCTGCAGATGGACGTTTCCCCCATTTCTACTT
AAGAACCACAAATGTAGATATTTTTATCATTTTTAAAATATACTTATCTATAAAAATAAA
AAGGGATCTCAATTATAAGGAAAAAAAATATAAATTGGTTTCGATAACTGGAGTAAATCT
TCTAAATATCCTTTAGGACATTTCAAGATGCTTATTGGTGATTCAGGAGATACTAAGGCT
GAAGGAGATGTTATTTTGCTAGAACACAACGTTGAATATAGAGCTTTTTCTAAGTAAGTT
CTTGATTGTTTACCTCCATAAGACGATAAATGGTAAATTCCATAATCAGAAATAAAAAAG
AGAGTTGACTTAAGAGGAATTAATGTCTGTAGTATTGATCCTCCTGGGTGTAAAGATATT
GATGATGCTCTTCACTGTATATCTTTACCAAATGGTAATTTTGAAGTTGGTGTACATATT
GCAGACGTAAGCTATTTTGTTCGTCCTGATACTGCTATTGACAAAGAAGCCTAAAATAGG
TATATTTCAAAAAATAAATTTATTTTAAATAGTAATTAATAAAAAATAAACAAAAAGATG
TACTACTGTCTATTTAGTAGATAGAAGAACAGATATGCTTCCAAAGCTTTTAACCGAAAC
ACTCTGCTCTTTAAAAGACGATGGTGACAGACTAGCATTTTCAGTTGTTTGGGTAATGGA
TAAAGATGCTAACATTATTGAAACTCGCTATCATAAGTCAATAATCAGATCAGTTGCTTC
TCTCAATTACGGTAAAGCACAATCTATGATTGATGACGTTAATGACAATTCAGAGCTTAC
CAAATCTATAAGGTAAATTTTTTATCTATCTTCTTTGATGATAAATATTTTTTAAAAAAT
TAATGTAATTGTTTTACTTTATTACTTAGAAATTTAAATATGCTTGCAAAGAAATTAAAG
TAAAAAAGAATCGAAAACGGTGCCTTATCATTAGCTTCAACTTAAGTTAAATTCACATTT
GATGATGAAACACATAATCCAGTTGATGTTTAATTCTACCAAATGTATGAAACTAACTCT
CTTATTGAAGAGTTTATGCTTCTTGGAAATGTTGCAGTTGCTGAAAAGATAGTATCTCAC
TTCCCTTCTATTTCTATTTTACGTTAGCACTCCTAGCCTAAACCTAAATAAATAAAAGAA
CTCTCATAAATTTTATAAAAGATTGGATTTAATCTTGATTACTCTTCAAACAGGGTAATA
TTTAACTTTTCTTGTTAAAGAATAGTTGTATTTAAGTTTTTTATTTTTAGAATTTAGCAG
ATAGTTTGGATAAAGTAAACAGACCTAATGATCATTTCTTTAATAAATTGGTTCGTATCA
TGACTACCAGATCCATGAATGAAGCCACATATTTTTGTACAGCTGATGCTGATTATCCTG
AATTTTATCATTATGGTTTGGCTGCACCCCTTTATACTCACTTCACCTCTCCAATTCGTA
GATATGCTGATGTTTTAGTTCACAGACTCCTTGCTGCCGCTATTGATATTGAAGCTATTC
CAGCATATATGTCAAACAAGCTTAAAATGGCTAAAATTTGCGAAAAAATGAATATGAGAA
ATCGTATGGCTCGTTTTGCATCACGCTCCAGCTCAGATTATAACACTTATTTATTTTTTA
AAGTAATTAATTAGATTTTTTATTTATTTAAGTAAAAAAAATTATAAAAAAACAGGATAA
ACAAATTGAAGAAGTTGCTATGGTATCAAGCATTAGTAAAACTGGTGCTACTGTTGTTGT
TCCTCGTTATGGTTTAGAAGGACAAATTAAATTTAGTGAAAAAGATTTAAAAGAAAACGA
GAAATTGTTGCAAGAGCTCAAACAAAATTAATCTTTAATAATTGTAATTTAAAATTTATT
TATGTGGATAATATTAATTAAAATAATATTTTAAAAATAGGATTTCGTTGTAAATGGAAA
CAGACATAAATTATTTGATTACCTTAAAGTAAGAGTAAGTGTTGGCATGAAAAACTTTCA
TAAATAAATTACTTTAGAATATTTAGGTCCTAACTGA