Identifiers and Description

Gene Model Identifier

TTHERM_00304170

Standard Name

DIS31 (Exosome complex exonuclease DIS3-1)

Aliases

PreTt21223 | 29.m00184 | 3696.m00007

Description

Nucleolar exosome component, involved in rRNA processing and RNA degradation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00304170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11576.19.997093137033517e-262RNB-like protein (1268 aa)
OxytrichaContig21538.0.g912.9996910481190226e-100RNB domain
DictyBaseDDB_G02787578.003693242657371e-87DDB_G0278757 on chromosome: 3
position 1123519 to 1127550
WormBaseWBGene000186126.001756404910437e-77locus:disl-2 DIS3-like exonu
clease 2 status:Confirmed
UniProt:Q09568 protein_id:CC
D71518.1
SGDYOL021C3.0011931572567413e-53DIS3 Exosome core complex cata
lytic subunit; possesses both
endonuclease and 3-5 exonuclea
se activity; involved in 3-5 R
NA processing and degradation
in both the nucleus and the cy
toplasm; has similarity to E.
coli RNase R and to human DIS3
Stentor CoeruleusSteCoe_210773.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00304170(coding)
ATGTAATTGACAATCTAAGAATAATATTAAAAAGAAGCCAAGAAAAGAAATTATAAGCAT
AAGAAATTTTATAAAAAATCAAATTTTCTTTTAAGATCAAAGATTTAATTGCTGACTATT
TAACAAACAAACAAACAAATAAACCTACAAACAGTTTATCAAAGATAGTTAATTTTTCTG
ATATATATTCACATTAATTAACCTTTATACTACATATAAAAAAACACATATAAATCAAAA
TAAACAAAGAAGATTTCTTATATTAATTAATAAATGATTAATTAAATACAAAGAGCCTAA
TTCATCCTAAAAAAAATGAATTAAAAAAATATTATTCAAAAAACGCCCTAGTTCTTACAA
TTTATAAACCAGTTCTAGAATTAATAGAAGAGTGAGTACGCTTAGATATTTATTACTAAG
AGTCCTAACTCTTCTTTTATTTCTGGCTAGCCTGCAGGATTTGACAATACAAACAGTCTT
TCTAGTTAAAACTCAGATTGTTCTTTATTTGGTAGCAATTAGAATAGAACTACTTATAGC
TCTTCCTCTAATAATAAGAAGCCATCTTCATACATAAACAGCAATGAGCATATTTAAAAC
TAGTGGATGAAAAAAGTTGATGACTTAAACAAGCAAACTGAGTAAGCAAATTAGTAGAAT
TTGCTTAAAAGAGGAAAATAGTGTGTTCAAGTAGATTCACATTTAGAGGATATACCTTCT
CAATCTTGGAAAGACTATTAAGAGCTATAAAAGCAATAGATTTTAATCGAAGAAGCAAAC
AGCAATTCATAGACATAGTAGAAAGAAGTAGATAAAAAAGCAGAATTAAAGAAGCAAAAG
AAAGTAAAAAGAGATAAAAATGGTGAAGTTATAATTAAAACAAGCAAGCAACCAGAAAAT
GCAGACTAATTGAGGGAGAGATTAGCTCTTCATGAGTAAATGATGCTTTTACCTAAAAAT
GAGAGAAATAAAGCCTTATTGAGCTAAAAGAAAAGAGATGAGCGTTGGGATAAGCAAGCT
CTTACACACAAATAGGTAGCTCATTATTCAGGTAGTGCAACTGAATAGGATAAGAAGAGA
GCTGTAGAAGAAATACTCGCCTAAAATCAAATAAAAAAACAAATAAAGGAATCTAAAAAG
GCTAAATTACCTGTGATCGAAAAAGAGTAAGCAGATATTTTTGATGAGATGATACAAATG
TTAAAAGAAAGTGGTGAAGTCAAGACAAAAAAAGAAAAAAAGCAAATTAAAGAAGATCTA
ATCACCGAAATAATTTCAGAAAAAGAATCTTAAAAAAATAAAAAGCAAAATTCAAGTTCT
TCAAATGGTGATGAATCAAAAGGAGTTAAGAGACATAATGAAAAGCGAAAAGCTAAAAAA
GAAAATTCTGACTTATTGTAAGAAGAAAATAATGAGTGCATAGAAGGCCATCCTTAGAAA
AAGGATAGTAAACAATCAAATAAAAACGGGTCAGATAGTTAAAATAATCAAGTTTAACTT
TCTGTATCTGATAAATTAGCAGATTTCCTTGATAATGAGCTCATTAATCCTTACAGAAAG
AATATAAAGCAAGAAAAGAAGTTATCAAAGAGTAAAAAAAGTCAAGCCCAAGAATACTTT
GATGAAGAATCTAAAGATGAATAAAAAAACCATAATTACAAAAATGGAATTAAAAAAAAT
AAAAATAAATAATTCTAATCTTTTGAGCCACATTGGTCCTCTCAATAAATTAATGATGCT
ATAAAATAAAAGAAAGCATTCAAGGGTGTTTATACTGCTAATGAGAAGAACCAATAACTG
GGTCGCATAAAATGTGATGAAATCGATGGTTTAGTATTTATAAATTCCTATATATACTAA
AACAGAGCACTTCACAATAGTGTTGTAGGTTTTGTGATTATTTAAGGCGATCCTTCAAGT
AGATTGAAAAATATTGAAGGTAATTCTGATATAAACTTGAAAAAGATTTAAGCAGATAAC
CTAAATGAAAACGAAGAATCACTAGACAAAAGTTTAGAGGAAGAAATCGATGATAACGAA
GAAGACTGGGAAACTGATTCTGAAGATAATCTACCTCCTGTAGATCAATCTAAATTAGTA
GCTAAAATTGTCTACATATTTGAAAATCCATACTAAAATGACAATATTGTCGGGTATCTT
GAAGAAGTCTAAGATAATAGATAAAAAAAGAATGGTAAAAAGAAATATTGGTTCATTCCT
AAGTACAGCAAATTACCTAAAATGTTACCTGTAGAATTCTCAGATGAGTTCTACCATTAA
GTTGAAGAAAATGACATCGATATTAGTAAAACCTATGTAGTTGGTAAAATGAAAGATTGG
AGCGAGGAAAGCTATTATCCATAAGCAACAATCAGTGAATGTCTAGGTGAGAGAGGTGAT
ATTGAAGTAGAATGTGATACACTTCTTAAGGAGTTCAATGTTTATAATCAAGATTTCACT
CCAGCAACTGAAGAATATTTAAATAAATACAGAGAATAGCTTAATGATAATGGCGAATAT
GTAATTCCTGAAAGTGAAAAGAATATTAGATGGGATCTAACAAAAGAAATTATATGTACT
ATTGATCCTCACGATGCTAAGGATTTAGATGATGCACTAAGCATTAAGTATTTGCACGAT
GATATATACGAAATAGGTGTTCATATTGCAGATGTTAGTCACTTTGTTTAGCCTAACACT
TCTTTAGATGATGATGCAAGATTAAGAACTACTTCTGTTTATCTCGTCCATAGAGTTATT
CCTATGCTTCCTCGTTTACTTTGTGAAAATCTATGTAGTTTAAACCCTAATGTTGAAAGA
TTAGCATTCACAGTATTTTTCTAAATGAAAGAAAATGGTGAAGTGTTATGGGATGGTCCT
ATTAGAATAGGAAAGAGTGTAATTAAATCTTGTAATAAGTTCTCTTATGATACTGTTTAG
ATGATGATAGAGAAGAAAATTAAGTCACCAGGAGAGCTTCCTGAGCATAATATACCTTAG
TAAGGAGTGGACTCACAAAAAATGTTTGATGATATTCTACTTTTAGCTAAGTTAGGTATG
AATAGAAGAGAAAGCAGATTTAAGGGTGGTGTTTTATCTATTGAAAGTGTTAAGAAAAGA
TTTAAACTCAATGAAAAATTATGGCCTGTAGATTTTACTCTTGAAGAAAGAAAGGATGCT
ATGTTTGTTGTAGAAGAATTTATGTTATTAGCAAACTAAATTGTAGCTAAAGAAATGGTA
AAACAATGCAAATCACTTGCTGTCCTTCGTTAACATTGCTATCCTTCAGATATAAAGCAA
AAGCAACTGAATGTAATTGCTAAGAAATTCGGACATTAAATTGATTTCTCCAGCTTACAG
GCTATTAACTAATCGATTGAAGATATTAAAAAAGATGATAAGCTCTCTTTTGAGAAAAAA
TTATTTTTAAAAAAATAAATGTTTTTGGTTTTAGAACAAGCTCTCTATTTTGTTGCAGAC
TAATTACCTCCCAGTGAATGGAAACACTTTGCATTAAACTTCGATGTTTACACTCACTTT
ACATCTCCTATTAGAAGATATCCTGATTTATTAGTTCACAGAGTTATGTACAGTATCCTT
TAATACAAATAGGATGCAGTCAAATATATTGAAAAATCCTCCTTACTTTCTATAATGGAG
GTGTGCAATGAAAATAAAGCCAAATCCAAACAAGTTTCAGATAACTGTTAAAAAATCTTC
ATGTGTCTCTACTTGAAAGACCACTCTGTTTAATCAAAAGGCATGGTAATTTCTTTCGGT
GTCACTAGCATGACCATTTTCATACCAGATCATGAAACCTAAAGAACTGTTTACTTCAAA
GATTATAAAAATATCTTGAAAGCTAAAGTAGAAAAAGAAAAAGATGGTAATAAGTTAATG
ATTACATATAAGACTGCAAGCATGCCTAGAGAAAACACTGTTTACTTCCATGAATTCTCT
CCCATTATAGTAAGTCTCACAAGCACAGATACTTTCCCTATCGATTATAAAGTAAAAATT
TCTCTTCCAGATCCAGATGATAAAAAAGTTACTCACGTTTTGGAATGA


>TTHERM_00304170(protein)
MQLTIQEQYQKEAKKRNYKHKKFYKKSNFLLRSKIQLLTIQQTNKQINLQTVYQRQLIFL
IYIHINQPLYYIQKNTYKSKQTKKISYINQQMINQIQRAQFILKKMNQKNIIQKTPQFLQ
FINQFQNQQKSEYAQIFITKSPNSSFISGQPAGFDNTNSLSSQNSDCSLFGSNQNRTTYS
SSSNNKKPSSYINSNEHIQNQWMKKVDDLNKQTEQANQQNLLKRGKQCVQVDSHLEDIPS
QSWKDYQELQKQQILIEEANSNSQTQQKEVDKKAELKKQKKVKRDKNGEVIIKTSKQPEN
ADQLRERLALHEQMMLLPKNERNKALLSQKKRDERWDKQALTHKQVAHYSGSATEQDKKR
AVEEILAQNQIKKQIKESKKAKLPVIEKEQADIFDEMIQMLKESGEVKTKKEKKQIKEDL
ITEIISEKESQKNKKQNSSSSNGDESKGVKRHNEKRKAKKENSDLLQEENNECIEGHPQK
KDSKQSNKNGSDSQNNQVQLSVSDKLADFLDNELINPYRKNIKQEKKLSKSKKSQAQEYF
DEESKDEQKNHNYKNGIKKNKNKQFQSFEPHWSSQQINDAIKQKKAFKGVYTANEKNQQL
GRIKCDEIDGLVFINSYIYQNRALHNSVVGFVIIQGDPSSRLKNIEGNSDINLKKIQADN
LNENEESLDKSLEEEIDDNEEDWETDSEDNLPPVDQSKLVAKIVYIFENPYQNDNIVGYL
EEVQDNRQKKNGKKKYWFIPKYSKLPKMLPVEFSDEFYHQVEENDIDISKTYVVGKMKDW
SEESYYPQATISECLGERGDIEVECDTLLKEFNVYNQDFTPATEEYLNKYREQLNDNGEY
VIPESEKNIRWDLTKEIICTIDPHDAKDLDDALSIKYLHDDIYEIGVHIADVSHFVQPNT
SLDDDARLRTTSVYLVHRVIPMLPRLLCENLCSLNPNVERLAFTVFFQMKENGEVLWDGP
IRIGKSVIKSCNKFSYDTVQMMIEKKIKSPGELPEHNIPQQGVDSQKMFDDILLLAKLGM
NRRESRFKGGVLSIESVKKRFKLNEKLWPVDFTLEERKDAMFVVEEFMLLANQIVAKEMV
KQCKSLAVLRQHCYPSDIKQKQLNVIAKKFGHQIDFSSLQAINQSIEDIKKDDKLSFEKK
LFLKKQMFLVLEQALYFVADQLPPSEWKHFALNFDVYTHFTSPIRRYPDLLVHRVMYSIL
QYKQDAVKYIEKSSLLSIMEVCNENKAKSKQVSDNCQKIFMCLYLKDHSVQSKGMVISFG
VTSMTIFIPDHETQRTVYFKDYKNILKAKVEKEKDGNKLMITYKTASMPRENTVYFHEFS
PIIVSLTSTDTFPIDYKVKISLPDPDDKKVTHVLE


>TTHERM_00304170(gene)
ATGTAATTGACAATCTAAGAATAATATTAAAAAGAAGCCAAGAAAAGAAATTATAAGCAT
AAGAAATTTTATAAAAAATCAAATTTTCTTTTAAGATCAAAGATTTAATTGCTGACTATT
TAACAAACAAACAAACAAATAAACCTACAAACAGTTTATCAAAGATAGTTAATTTTTCTG
ATATATATTCACATTAATTAACCTTTATACTACATATAAAAAAACACATATAAATCAAAA
TAAACAAAGAAGATTTCTTATATTAATTAATAAATGATTAATTAAATACAAAGAGCCTAA
TTCATCCTAAAAAAAATGAATTAAAAAAATATTATTCAAAAAACGCCCTAGTTCTTACAA
TTTATAAACCAGTTCTAGAATTAATAGAAGAGTGAGTACGCTTAGATATTTATTACTAAG
AGTCCTAACTCTTCTTTTATTTCTGGCTAGCCTGCAGGATTTGACAATACAAACAGTCTT
TCTAGTTAAAACTCAGATTGTTCTTTATTTGGTAGCAATTAGAATAGAACTACTTATAGC
TCTTCCTCTAATAATAAGAAGCCATCTTCATACATAAACAGCAATGAGCATATTTAAAAC
TAGTGGATGAAAAAAGTTGATGACTTAAACAAGCAAACTGAGTAAGCAAATTAGTAGAAT
TTGCTTAAAAGAGGAAAATAGTGTGTTCAAGTAGATTCACATTTAGAGGATATACCTTCT
CAATCTTGGAAAGACTATTAAGAGCTATAAAAGCAATAGATTTTAAGTAAAAATAATAGA
AAAACATTAATTATGAATTTCATAAGATTATTTCCATTAAATTTATAAATATTTAATTTC
TTAAAATTCATAGTCGAAGAAGCAAACAGCAATTCATAGACATAGTAGAAAGAAGTAGAT
AAAAAAGCAGAATTAAAGAAGCAAAAGAAAGTAAAAAGAGATAAAAATGGTGAAGTTATA
ATTAAAACAAGCAAGCAACCAGAAAATGCAGACTAATTGAGGGAGAGATTAGCTCTTCAT
GAGTAAATGATGCTTTTACCTAAAAATGAGAGAAATAAAGCCTTATTGAGCTAAAAGAAA
AGAGATGAGCGTTGGGATAAGCAAGCTCTTACACACAAATAGGTAGCTCATTATTCAGGT
AGTGCAACTGAATAGGATAAGAAGAGAGCTGTAGAAGAAATACTCGCCTAAAATCAAATA
AAAAAACAAATAAAGGAATCTAAAAAGGCTAAATTACCTGTGATCGAAAAAGAGTAAGCA
GATATTTTTGATGAGATGATACAAATGTTAAAAGAAAGTGGTGAAGTCAAGACAAAAAAA
GAAAAAAAGCAAATTAAAGAAGATCTAATCACCGAAATAATTTCAGAAAAAGAATCTTAA
AAAAATAAAAAGCAAAATTCAAGTTCTTCAAATGGTGATGAATCAAAAGGAGTTAAGAGA
CATAATGAAAAGCGAAAAGCTAAAAAAGAAAATTCTGACTTATTGTAAGAAGAAAATAAT
GAGTGCATAGAAGGCCATCCTTAGAAAAAGGATAGTAAACAATCAAATAAAAACGGGTCA
GATAGTTAAAATAATCAAGTTTAACTTTCTGTATCTGATAAATTAGCAGATTTCCTTGAT
AATGAGCTCATTAATCCTTACAGAAAGAATATAAAGCAAGAAAAGAAGTTATCAAAGAGT
AAAAAAAGTCAAGCCCAAGAATACTTTGATGAAGAATCTAAAGATGAATAAAAAAACCAT
AATTACAAAAATGGAATTAAAAAAAATAAAAATAAATAATTCTAATCTTTTGAGCCACAT
TGGTCCTCTCAATAAATTAATGATGCTATAAAATAAAAGAAAGCATTCAAGGTAATAAAT
AAAAAAAATATTTTTAACAAATTTGGAATCTCTTATTGATAAAAAAAATTGATTTAAGGA
AATTTATTGAATGAATATTTGATTATTCTTGTCTCAATAAACCTTTTTAAAAACAATTGT
TTTAAAAGATTCCTTTCATTAAAAATGCACATAAAATTTTTACAAAAATATTATTTAAAT
TTAATGAATGGATTTGTTAGTTTTATTTAGAATAATATTATTTTTTTGATTTTATTAAAA
AAGGAAATATCAACAATTTTAACAATTATTTTATACTTATTCTATTTAGGGTGTTTATAC
TGCTAATGAGAAGAACCAATAACTGGGTCGCATAAAATGTGATGAAATCGATGGTTTAGT
ATTTATAAATTCCTATATATACTAAAACAGAGCACTTCACAATAGTGTTGTAGGTTTTGT
GATTATTTAAGGCGATCCTTCAAGTAGATTGAAAAATATTGAAGGTAATTCTGATATAAA
CTTGAAAAAGATTTAAGCAGATAACCTAAATGAAAACGAAGAATCACTAGACAAAAGTTT
AGAGGAAGAAATCGATGATAACGAAGAAGACTGGGAAACTGATTCTGAAGATAATCTACC
TCCTGTAGATCAATCTAAATTAGTAGCTAAAATTGTCTACATATTTGAAAATCCATACTA
AAATGACAATATTGTCGGGTATCTTGAAGAAGTCTAAGATAATAGATAAAAAAAGAATGG
TAAAAAGAAATATTGGTTCATTCCTAAGTACAGCAAATTACCTAAAATGTTACCTGTAGA
ATTCTCAGATGAGTTCTACCATTAAGTTGAAGAAAATGACATCGATATTAGTAAAACCTA
TGTAGTTGGTAAAATGAAAGGTAATTTATTCAATTTTAGTTAATAATTCATAAAAAAAAG
TTTGATTTTTATAAAATTATTTCAATTTAGATATTAATAAATTAAAAATTTTTAAATTAT
TTAAAAGATTGGAGCGAGGAAAGCTATTATCCATAAGCAACAATCAGTGAATGTCTAGGT
GAGAGAGGTGATATTGAAGTAGAATGTGATACACTTCTTAAGGAGTTCAATGTTTATAAT
CAAGATTTCACTCCAGCAACTGAAGAATATTTAAATAAATACAGAGAATAGCTTAATGAT
AATGGCGAATATGTAATTCCTGAAAGTGAAAAGAATATTAGATGGGATCTAACAAAAGGT
AAAAATAAAAAATAAAATTATATTATTTAAATCAAAATATTTTAAATTTAATAGAAATTA
TATGTACTATTGATCCTCACGATGCTAAGGATTTAGATGATGCACTAAGCATTAAGTATT
TGCACGATGATATATACGAAATAGGTGTTCATATTGCAGATGTTAGTCACTTTGTTTAGC
CTAACACTTCTTTAGATGATGATGCAAGATTAAGAACTACTTCTGTTTATCTCGTCCATA
GAGTAATTAATTAATTACTTATATAATTATATTTTCATTTAATAATTAAATTATTTAATA
TTGAATATAGGTTATTCCTATGCTTCCTCGTTTACTTTGTGAAAATCTATGTAGTTTAAA
CCCTAATGTTGAAAGATTAGCATTCACAGTATTTTTCTAAATGAAAGAAAATGGTGAAGT
GTTATGGGATGGTCCTATTAGAATAGGAAAGAGTGTAATTAAATCTTGTAATAAGTTCTC
TTATGATACTGTTTAGATGATGATAGAGAAGAAAATTAAGTCACCAGGGTAATAAATAAT
ATAATTTATAAAAAAAATTTATTTTATTTTTTAATACAAAAAGAGAGCTTCCTGAGCATA
ATATACCTTAGTAAGGAGTGGACTCACAAAAAATGTTTGATGATATTCTACTTTTAGCTA
AGTTAGGTATGAATAGAAGAGAAAGCAGATTTAAGGGTGGTGTTTTATCTATTGAAAGTG
TTAAGAAAAGATTTAAACTCAATGAAAAATTATGGCCTGTAGATTTTACTCTTGAAGAAA
GAAAGGATGCTATGTTTGTTGTAGAAGAATTTATGTTATTAGCAAACTAAATTGTAGCTA
AAGAAATGGTAAAACAATGCAAATCACTTGCTGTCCTTCGTTAACATTGCTATCCTTCAG
ATATAAAGCAAAAGCAACTGAATGTAATTGCTAAGAAATTCGGACATTAAATTGATTTCT
CCAGCTTACAGGCTATTAACTAATCGATTGAAGATATTAAAAAAGATGATAAGCTCTCTT
TTGAGAAAAAATTATTTTTAAAAAAATAAATGTTTTTGGTTTTAGAACAAGCTCTCTATT
TTGTTGCAGACTAATTACCTCCCAGTGAATGGAAACACTTTGCATTAAACTTCGATGTTT
ACACTCACTTTACATCTCCTATTAGAAGATATCCTGATTTATTAGTTCACAGAGTTATGT
ACAGTATCCTTTAATACAAATAGGATGCAGTCAAATATATTGAAAAATCCTCCTTACTTT
CTATAATGGAGGTGTGCAATGAAAATAAAGCCAAATCCAAACAAGTTTCAGATAACTGTT
AAAAAGTAAGAACAAATTAATTTTAATTAATTTATTTACAGATATTTATTAATCTCATAA
TAGATCTTCATGTGTCTCTACTTGAAAGACCACTCTGTTTAATCAAAAGGCATGGTAATT
TCTTTCGGTGTCACTAGCATGACCATTTTCATACCAGATCATGAAACCTAAAGAGTAATT
GATTATTATTTAATAATTTTATAAAATAATTTTTTTTAATTTAATAAATTAAGACTGTTT
ACTTCAAAGATTATAAAAATATCTTGAAAGCTAAAGTAGAAAAAGAAAAAGATGGTAATA
AGTTAATGATTACATATAAGACTGCAAGCATGCCTAGAGAAAACACTGTTTACTTCCATG
TACATAATTTCAAATTTATATTTGTGTTGCTAATTGTTTAAAAATAAATTTAAATAGGAA
TTCTCTCCCATTATAGTAAGTCTCACAAGCACAGATACTTTCCCTATCGATTATAAAGTA
AAAATTTCTCTTCCAGATCCAGATGATAAAAAAGTTACTCACGTTTTGGAATGA