Identifiers and Description

Gene Model Identifier

TTHERM_00794280

Standard Name

DIM1 (DIMethylase of 18S rRNA 1)

Aliases

PreTt21427 | 134.m00107

Description

Mitosis protein DIM1 containing protein; member of spliceosomal complex; involved in pre-ribosomal RNA processing and G2/M transition during cell cycle

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00794280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13303.17.00248144504223e-103mitosis protein DIM1 containin
g protein (143 aa)
WormBaseWBGene002351022.9991172563576427e-86status:Confirmed UniProt:L8E
6I4 protein_id:CCQ25653.1
OxytrichaContig13930.0.g341.0001478224244938e-84Mitosis protein DIM1
DictyBaseDDB_G02754074.000010081770683e-74txnl4a on chromosome: 2 positi
on 5420626 to 5421449
SGDYPR082C9.996907204735647e-62DIB1 17-kDa component of the U
4/U6aU5 tri-snRNP, plays an es
sential role in pre-mRNA splic
ing, orthologue of hDIM1, the
human U5-specific 15-kDa prote
in
Stentor CoeruleusSteCoe_358371.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000047

Sequences

>TTHERM_00794280(coding)
ATGTCTTATTTATTACCTCACTTAAAGAATGGTTGGGAAGTAGATCAAGCTATCCTTCAT
GAGGAAGAAAGATTAGTTATTATTAGATTTGGTCATGATTGGGACCCTGAATGCATGAAA
ATGGATGAAATCCTCTATAAAGTAGCTGATAAGATAAAAAATTTTGCTGTAATTTATTTA
GTTGACATTACAAAAGTACCTGATTTTAACACTATGTATGAATTGTATGATCCCGTAACT
GTTATGTTCTTTTTCAGAAACAAACATATGATGATTGATTTAGGTACAGGTAATAACAAT
AAAATTAATTGGGCCATGAATAATAAATAAGAATTTATTGACATATGCGAAATCGTTTAT
CGTGGTGCTCGTAAAGGAAAAGGTCTAGTTATTGCTCCAAAAGATTATTCAACTAAATAC
AAATATTGA


>TTHERM_00794280(protein)
MSYLLPHLKNGWEVDQAILHEEERLVIIRFGHDWDPECMKMDEILYKVADKIKNFAVIYL
VDITKVPDFNTMYELYDPVTVMFFFRNKHMMIDLGTGNNNKINWAMNNKQEFIDICEIVY
RGARKGKGLVIAPKDYSTKYKY


>TTHERM_00794280(gene)
ATGTCTTATTTATTACCTCACTTAAAGAATGGTTGGGAAGTAGATCAAGCTATCCTTCAT
GAGGAAGAAAGATTAGTTATTATTAGATTTGGTCATGATTGGGACCCTGAATGCATGAAA
ATGGATGAAATCCTCTATAAAGTAGCTGATAAGATAAAAAATTTTGCTGTAATTTATTTA
GTTGACATTACAAAAGTACCTGATTTTAACACTATGTATGAATTGTATGATCCCGTAACT
GTTATGTTCTTTTTCAGAAACAAACATATGATGATTGATTTAGGTACAGGTAATAACAAT
AAAATTAATTGGGCCATGAATAATAAATAAGAATTTATTGACATATGCGAAATCGTTTAT
CGTGGTGCTCGTAAAGGAAAAGGTCTAGTTATTGCTCCAAAAGATTATTCAACTAAATAC
AAATATTGA