Identifiers and Description

Gene Model Identifier

TTHERM_00686240

Standard Name

DIE5 (Defective in IES Excision 5)

Aliases

PreTt18238 | 104.m00170 | 3732.m00083

Description

Defective in IES excision; required for macronuclear development; known homolog in Paramecium genome

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00686240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_337140
Tetrahymena borealisEI9_17410.12.000127961544401e-120hypothetical protein (231 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:20495055: Matsuda A, Shieh AW, Chalker DL, Forney JD (2010) The conjugation-specific Die5 protein is required for development of the somatic nucleus in both Paramecium and Tetrahymena. Eukaryotic cell 9(7):1087-99

Sequences

>TTHERM_00686240(coding)
ATGAGCGAAGACTTTATTTAAGGGATAGCAATCATTGATGGCACGCACTTAAAAATAAAA
TAAGATAAAATGAGTTTTTTATTGTTGGTAAAAGCGATTTAGATTCCTAATTCTAAATCT
CTTAACATCATGTTGGCAGATAGCTCAGATAAATTTTGGCTCGGAGATTTTAATGAGCGA
AAAATTAAAGAAATCAAGGAATAAATGAAGCTCACAGGAACTTATTAAGAATTTTTCAAA
GCTATGAAAGAAATGCTCCAAAAAAAGAGCTTTGAGATAGAGCTAAAAGCTGATTATAAT
ATGGATATTATTATCGAATTCTAGTTTTCTGGTATAATCATTAATGCTCGCTTTCAAATA
GGAAAACCTTTTAAAAGGGATGATAACCCAACTATTTCTTACAATCTTTTAAAGGTATTC
ACATTAGATTTATACAATGCATATCAAAAAGAGAGAGAAGAAACACTTAAAGAAAATTAA
GATTTAAAAGCTCAATTAGAAAACATAAACAATTAAATTAAGGAGGGTTTTCTAATTAAA
TGTAATAATAACTTAATTAACTAAGAAGGAGCTAGTAATATTGATGCAATAAATAGTATA
AAAAAAGTTAAACCTAATACATGTATAATTAATCCTTAAAGACGTAAAAGGAAGGTTTTA
GGTGCTAAAATTGGCTCGATTGAAGATGATTGA


>TTHERM_00686240(protein)
MSEDFIQGIAIIDGTHLKIKQDKMSFLLLVKAIQIPNSKSLNIMLADSSDKFWLGDFNER
KIKEIKEQMKLTGTYQEFFKAMKEMLQKKSFEIELKADYNMDIIIEFQFSGIIINARFQI
GKPFKRDDNPTISYNLLKVFTLDLYNAYQKEREETLKENQDLKAQLENINNQIKEGFLIK
CNNNLINQEGASNIDAINSIKKVKPNTCIINPQRRKRKVLGAKIGSIEDD


>TTHERM_00686240(gene)
ATGAGCGAAGACTTTATTTAAGGGATAGCAATCATTGATGGCACGCACTTAAAAATAAAA
TAAGATAAAATGAGTTTTTTATTGTTGGTAAAAGCGATTTAGATTCCTAATTCTAAATCT
CTTAACATCATGTTGGCAGATAGCTCAGATAAATTTTGGCTCGGAGATTTTAATGAGCGA
AAAATTAAAGAAATCAAGGAATAAATGAAGCTCACAGGAACTTATTAAGAATTTTTCAAA
GCTATGAAAGAAATGCTCCAAAAAAAGAGCTTTGAGATAGAGCTAAAAGCTGATTATAAT
ATGGATATTATTATCGAATTCTAGTTTTCTGGTATAATCATTAATGCTCGCTTTCAAATA
GGTAAAAATTAACCTTAAAAATCAAAAATTTAATTTGAAAATTAAATATTATTTTTAAAT
TAATCAAAAAGGAAAACCTTTTAAAAGGGATGATAACCCAACTATTTCTTACAATCTTTT
AAAGGTATTCACATTAGATTTATACAATGCATATCAAAAAGAGAGAGAAGAAACACTTAA
AGAAAATTAAGATTTAAAAGCTCAATTAGAAAACATAAACAATTAAATTAAGGAGGGTTT
TCTAATTAAATGTAATAATAACTTAATTAACTAAGAAGGAGCTAGTAATATTGATGCAAT
AAATAGTATAAAAAAAGTTAAACCTAATACATGTATAATTAATCCTTAAAGACGTAAAAG
GAAGGTTTTAGGTGCTAAAATTGGCTCGATTGAAGATGATTGA