Identifiers and Description

Gene Model Identifier

TTHERM_00079230

Standard Name

DIC3 (Dynein Intermediate Chain 3)

Aliases

PreTt10169 | 5.m00520 | 3828.m01432 | IC69 | IC3

Description

IC3 flagellar outer dynein arm intermediate protein putative; Intermediate chain subunit of ciliary three-headed outer arm dynein (OAD)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF04702 ) Vicilin N terminal region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00079230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_10220
Tetrahymena borealisEI9_07016.19.997093137033517e-262hypothetical protein (659 aa)
OxytrichaContig21752.0.g209.997093137033517e-262WD domain, G-beta repeat
DictyBaseDDB_G02808493.000555717977434e-27dicA on chromosome: 3 position
3856978 to 3859184
WormBaseWBGene000159273.001003044337619e-17locus:dyci-1 status:Confirme
d UniProt:O45087 protein_i
d:CCD64991.1
SGDYDR128W0.000005000363240844623MTC5 Subunit of the SEA (Seh1-
associated) complex, a coatome
r-related complex that associa
tes dynamically with the vacuo
le; has N-terminal WD-40 repea
ts and a C-terminal RING motif
; mtc5 is synthetically sick w
ith cdc13-1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:10970738: Strauss-Soukup JK, Strobel SA (2000) A chemical phylogeny of group I introns based upon interference mapping of a bacterial ribozyme. Journal of molecular biology 302(2):339-58
  3. Ref:10101194: Ikawa Y, Naito D, Aono N, Shiraishi H, Inoue T (1999) A conserved motif in group IC3 introns is a new class of GNRA receptor. Nucleic acids research 27(8):1859-65

Sequences

>TTHERM_00079230(coding)
ATGGCTGAGTATTTCACATATTCAAAGAAAAGAAAGGAATTCAACAATCCTATTAACTTT
TAGGACACCGAGACCAGATATGGTGGCATTTAAAATTAAGTTGTCAATATCAATCAATAT
GTTTAGCGTAATCCAAACTTTATTGACTTAGATAACATAGCAGAACTCTCAGAGCATTCA
GTAAATACAGAAAGAGTTAAAACTGGTGATCGTGGTATGAGTCACAAAGAAGGAGGTTGG
CCCGGAAATGTTGATCCTAATGAAGCTTAAGAAACTGGTAGATTTAAAAAAAGAATTGAA
AAGGATACCAGTTTCCCTCAAGCTGTTAAAGATTTAAAGGAAGGAGTTGAAAAGTGCATT
TATTAAAATAATTAAATCGACCTCTTAGAGGAATATTTTGAAGGTGAAACATCTGAACAC
GTTGTTGAGAATCTCTCTTCAAAGACCCTCATGCTTTTCAAGGATGAAAAAGAAATTTGT
AAAAGATCTGTTTCTGAAATTTCATGGCATCCTGAAGGACCTACTAAGGTAGCTGTTTCT
TATGCTATTATGCGTTTCTAATAGATGCCTGAAAAAATGCCCACTTAAGCTTACGTTTGG
GATTTGTTGAACCCTAATTCCCCTGAAATTAAATTAATGTCTCCTTCAGCTGTAACAAAT
ATTTCATACAATTAAAAAATACCTGATCAAATTGGTGGTGGTTGCTACAACGGTCTTCTT
GCTGTTTGGGATGGAAGAAAAGGTGAAAACCCTATTATGATTTCTCCAGTCGAAAACTCC
CATTATGAACCTGTCACCCATTTCCATTGGTTGATGAGCAAAACAGGTAGTGAATGTGTT
ACAACAAGTACTGATGGTAAAGTTATGTGGTGGGATACTAGAAAATTCGAAGCTGGTCCT
GTTGAAAAGCTAAATATTATTGAAGGTTTAGGTGAAAATGAAGAAATCATTGGTGGTACT
GCTCTTGAATACAACGTCGAAGCTGGTCCTAGTAAATTTTTGATTGGTACAGAATCAGGT
TCAATTTTAACTGCAAACAAGAAACTTAAAAAGCCTGTTGAAATCACAACTAGATATGGA
TTAGATCAAGGCAGACATTTAGGTCCTGTTTACAGTATTAATAGATCTAACTAAAATCCT
AAATATTTCTTATCAGTTGGTGACTGGTCTTGTAAAATATGGGTTGAAGATCTTAAAACT
CCTATCATCAGAACCAAATATCATGGTTCTTACCTTTCTGATGGTTGCTGGTCTCCCACT
AGATCAGGTGCCTTCTTCTTAGTTAGGAGAGATGGTTGGATGGATGTCTGGGATTACTAC
TACAGACAAAACGAAATCGCTTTCTCTCACAAAGTTAGTGACTCACCTTTAACATGCATT
AAAATTAACTAAACTGGTGGTGCCTACCATAATTCTGGTAAGCTCTGTGCTATTGGTGAT
TAAGATGGTACTGTTACTATTCTTGAATTATGTGATTCTCTTTACACAATGTAACCCAAG
GAAAAAGATATTATTAACGAAATGTTCGAAAGAGAATACAGAAAGGAAAAGAACTTGGAA
ACAATCAAAAAGTAATAGGAATTAGCTAAAAGATAAGTTTAAAAAGATATGGGTAGCCAA
AAAGAAAAGTGGGAAAAGAAGAAACTTGAAATGATTGAAACTGCTGAAGCCAGTTTCCAT
GAAAATCTTGCTAAGAACCCTGTTAATGAAGAAGAATTTAATGAACTTGACTCACCTTCT
GAAAAGAGAAAGAAAACTAATTAAAATTAAGGTAGAGAATAAGAAGAATAAAGCAGAGAA
GAATAAGAAGCATCTGGTAACTTCAATTAACAACAATAGTAATAATAAGAAGAAGAATAG
TAGTAAGAAGGGGAATAATAACACCATTAAAATCAAGAACACCAAAACGGATAAGGACAT
GAAAATGGCTAAGAGGAAGGTGAAGAAAATGGTGAAGAAGGTAATTAATAAGAAAATGAA
GGATAAGAAGAAAACGAATAATAATAAGAATGA


>TTHERM_00079230(protein)
MAEYFTYSKKRKEFNNPINFQDTETRYGGIQNQVVNINQYVQRNPNFIDLDNIAELSEHS
VNTERVKTGDRGMSHKEGGWPGNVDPNEAQETGRFKKRIEKDTSFPQAVKDLKEGVEKCI
YQNNQIDLLEEYFEGETSEHVVENLSSKTLMLFKDEKEICKRSVSEISWHPEGPTKVAVS
YAIMRFQQMPEKMPTQAYVWDLLNPNSPEIKLMSPSAVTNISYNQKIPDQIGGGCYNGLL
AVWDGRKGENPIMISPVENSHYEPVTHFHWLMSKTGSECVTTSTDGKVMWWDTRKFEAGP
VEKLNIIEGLGENEEIIGGTALEYNVEAGPSKFLIGTESGSILTANKKLKKPVEITTRYG
LDQGRHLGPVYSINRSNQNPKYFLSVGDWSCKIWVEDLKTPIIRTKYHGSYLSDGCWSPT
RSGAFFLVRRDGWMDVWDYYYRQNEIAFSHKVSDSPLTCIKINQTGGAYHNSGKLCAIGD
QDGTVTILELCDSLYTMQPKEKDIINEMFEREYRKEKNLETIKKQQELAKRQVQKDMGSQ
KEKWEKKKLEMIETAEASFHENLAKNPVNEEEFNELDSPSEKRKKTNQNQGREQEEQSRE
EQEASGNFNQQQQQQQEEEQQQEGEQQHHQNQEHQNGQGHENGQEEGEENGEEGNQQENE
GQEENEQQQE


>TTHERM_00079230(gene)
ATGGCTGAGTATTTCACATATTCAAAGAAAAGAAAGGAATTCAACAATCCTATTAACTTT
TAGGACACCGAGACCAGATATGGTGGCATTTAAAATTAAGTTGTCAATATCAATCAATAT
GTTTAGCGTAATCCAAACTTTATTGACTTAGATAACATAGCAGAACTCTCAGAGCATTCA
GTAAGTTTTTTTTAAATGGCCTAAAATACTAATAGTTTTAGAAGAAACAACAAAATTGAG
TCTTTAAGTAAAAAAATATTTTAAATATTAGGTAAATACAGAAAGAGTTAAAACTGGTGA
TCGTGGTATGAGTCACAAAGAAGGAGGTAATTGGGAATTATTATTTATTTATAAAAAATA
AAACAAGCATCTAACTAAAACAATAAACCAATCATAAAATAGATTTTGAACTAAATAAAA
TAGAATTTAAAAAATTAGATTAAAAAAAACTGATTTTAATTTTATATTAAATTTACTTTT
TTTTATTTTAGGTTGGCCCGGAAATGTTGATCCTAATGAAGCTTAAGAAACTGGTAGATT
TAAAAAAAGAATTGAAAAGGATACCAGTTTCCCTCAAGCTGTTAAAGATTTAAAGGAAGG
AGTTGAAAAGTGCATTTATTAAAATAATTAAATCGACCTCTTAGAGGAATATTTTGAAGG
TGAAACATCTGAACACGTTGTTGAGAATCTCTCTTCAAAGACCCTCATGCTTTTCAAGGA
TGAAAAAGAAATTTGTAAAAGATCTGTTTCTGAAATTTCATGGCATCCTGAAGGTAATTT
AACATTAACATAATATGAATAAAAGTTTATTTGATTGTTTAGATTCATAAAGCATAAACA
CAAGCCAAATTTTATACTGAATCTAAAATTAAGACATTTTAAATTAACATATAATGCTTT
TTTTTAGATTTAAATTGTTTTTATTTTAAAATTAGGACCTACTAAGGTAGCTGTTTCTTA
TGCTATTATGCGTTTCTAATAGATGCCTGAAAAAATGCCCACTTAAGCTTACGTTTGGGA
TTTGTTGAACCCTAATTCCCCTGAAATTAAATTAATGTCTCCTTCAGCTGTAACAAATAT
TTCATACAATTAAAAAATACCTGATCAAATTGGTGGTGGTTGCTACAACGGTCTTCTTGG
TAATTATTTATTTAAGCATTATTTATTTTTACACAAATCTTAGTTTAATATAAATTTTTT
TGAGCGCAAATCCTTTTAAATTTTGAAACGCTTCTTAATTTAAAAATAATAATCAATTTT
TTTTTGAATTTTTAATTATTTTTTTACAAAATATTAATTGACATTCTCTTAAAAATATTT
TTAATTTTAATGTATTCAAGTTTTTATAATTAAATTATTTTATTTTAAATAGCTGTTTGG
GATGGAAGAAAAGGTGAAAACCCTATTATGATTTCTCCAGTCGAAAACTCCCATTATGAA
CCTGTCACCCATTTCCATTGGTTGATGAGCAAAACAGGTAGTGAATGTGTTACAACAAGT
ACTGATGGTAAAGTTATGTGGTGGGATACTAGAAAATTCGAAGCTGGTCCTGTTGAAAAG
CTAAATATTATTGAAGGTTTAGGTGAAAATGAAGAAATCATTGGTGGTACTGCTCTTGAA
TACAACGTCGAAGCTGGTGTAATTAAATAATTAAATAAATAAATTATTAAAGGAAAGAAA
GAAAAAAAGAAATAAGAGTTATAAAAATAAATAATTTTATTAAATTAATGAATGAAAGAA
TAGAGTTAAAAATTATCTCATTGAATTATATAAAAAAATATTTTATTAATATTAATTTTT
AAATTATGAACAGCCTAGTAAATTTTTGATTGGTACAGAATCAGGTTCAATTTTAACTGC
AAACAAGAAACTTAAAAAGCCTGTTGAAATCACAACTAGATATGGATTAGATCAAGGCAG
ACATTTAGGTCCTGTTTACAGTATTAATAGATCTAACTAAAATCCTAAATATTTCTTATC
AGTTGGTGACTGGTCTTGTAAAATATGGGTTGAAGATCTTAAAACTCCTATCATCAGAAC
CAAATATCATGGTTCTTACCTTTCTGATGGTTGCTGGTCTCCCACTAGATCAGGTGCCTT
CTTCTTAGTTAGGAGAGTAATTAGTTTTATTGAATGTTTTTATTCAAATTAATAATGAAA
ATTAATTAATAGGATGGTTGGATGGATGTCTGGGATTACTACTACAGACAAAACGAAATC
GCTTTCTCTCACAAAGTTAGTGACTCACCTTTAACATGCATTAAAATTAACTAAACTGGT
GGTGCCTACCATAATTCTGGTAAGCTCTGTGCTATTGGTGATTAAGATGGTAAACAATCA
GATAAATTTTTTATTGTTGTAAGTATTAATTTTTATTGTTAAAAAAATAGGTACTGTTAC
TATTCTTGAATTATGTGATTCTCTTTACACAATGTAACCCAAGGAAAAAGATATTATTAA
CGAAGTAAATAGTTTTGAATTAAAAGTTTAAATAATTAAAAAATAATATAAATAAATGAT
AGATGTTCGAAAGAGAATACAGAAAGGAAAAGAACTTGGAAACAATCAAAAAGTAATAGG
AATTAGCTAAAAGATAAGTTTAAAAAGATATGGGTAGCCAAAAAGAAAAGTGGGAAAAGA
AGAAACTTGAAATGATTGAAACTGCTGAAGCCAGTTTCCATGAAAATCTTGCTAAGAACC
CTGTTAATGAAGAAGAATTTAATGAACTTGACTCACCTTCTGAAAAGAGAAAGAAAACTA
ATTAAAATTAAGGTAGAGAATAAGAAGAATAAAGCAGAGAAGAATAAGAAGCATCTGGTA
ACTTCAATTAACAACAATAGTAATAATAAGAAGAAGAATAGTAGTAAGAAGGGGAATAAT
AACACCATTAAAATCAAGAACACCAAAACGGATAAGGACATGAAAATGGCTAAGAGGAAG
GTGAAGAAAATGGTGAAGAAGGTAATTAATAAGAAAATGAAGGATAAGAAGAAAACGAAT
AATAATAAGAATGA