Identifiers and Description

Gene Model Identifier

TTHERM_00128280

Standard Name

DFB1 (Deep fibre bundle protein 1)

Aliases

PreTt09392 | 9.m00413 | 3699.m00121

Description

localizes to the deep fibre bundle of the oral apparatus, forms filamentous structures, associates with basal bodies and longitudinal microtubules

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08647 ) BRE1 E3 ubiquitin ligase
  • ( PF00038 ) Intermediate filament protein
  • ( PF04508 ) Viral A-type inclusion protein repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00128280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09151.19.997093137033517e-262hypothetical protein (409 aa)
OxytrichaContig556.1.g235.000574419929632e-30Autophagy protein 16 (ATG16)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21127172: Gould SB, Kraft LG, van Dooren GG, Goodman CD, Ford KL, Cassin AM, Bacic A, McFadden GI, Waller RF (2011) Ciliate pellicular proteome identifies novel protein families with characteristic repeat motifs that are common to alveolates. Molecular biology and evolution 28(3):1319-31

Sequences

>TTHERM_00128280(coding)
ATGTCAAACTACAAAAATCAATCATCTTACTCTCCAATTTCTAGATAGGAAGGATATGAA
AAGGATATCATCATTTCTTAATTGAAATCAGAAATATGGGAACTTAAGTAGCAAGAGCGT
GAATATTCTGAAATCATCGCACATAACAAGAATCTTGAAGGTTAGTACTAACTTTTGAAG
GATGAGAAGTTCAGAATAGAAAATGAATTGAAGCAAAAGAATCATGAATAAATCAAGCAA
TTAGCTAACTACAGATAGCGCGTTGATTAGCTAGAATAAGCTTTAACTGAAAGAAAGATA
GAAATTTAAGAATTAAGAGCTGAAAATATTGCCTAAAGGGAGCATTGCGATCACAAGTAG
CTTGAAATTTCTAGACTTAAAACTGAATAAATCCACTTAGAGGATACTATAACTAGATTG
TAGAATGAGAATATCTCAATTAAAAATGAATTAGATGATTTAAGAGATTACAAAAGAAAA
GTCAACAGCGATATGGAATTACTTATCAACACAAACGATAATCTCCAAAGCAAGACCTTA
GATTAAGACAAGATTATTAGATCATTAGATTATGAAAAGATTTAACAATAGAGATATGTT
GATTCTTTGAAGAGTTAAATTACTTAGTTAGAAAATGAATTGATTAACAAGAGTGACAAC
ATTAAAGACGTTTAAAATCAAGTAATTGATTACAAATAATAGTTGGTATCCTTAGAAAGA
GCTTTAGAAGATGTTGAAAAGCTTAGAGAAAAATATAAATAAGAGAGCCTTCATCACTAG
ACTTGTCTTAAGGAAGAAATTAGCAAGAACTTTGATTTGAATTAGCAAATTCTTAACTTA
GACAGCAATCTTAGGAGCAAAGTCAACTTTATTGATGAATTGAAGCGTCAGTTAGACGAA
GTAAAGAGAGACGTCACAGAAACCCTTGAATAAAACGATTTCATTTCCAATGAATTAGAA
AGATATAAGAGAAACTTTGATATTGCCTCAGCCTAAAATGCTGAATTATTGAGATAATTA
GAGCAATTCAATGAATAAGATGAAGAAATAAGACATATTTTAGATAGAAAGGGATAAGTT
AGAGAAATTAAAACAAGAGTTGATAACTACTTGAGATAATCTTAAAATGACTTCAGAATG
GTATCTCCAAACAACAGGAGTTATCTTGCTGCCTCTGGTAAACATAACAGAAGAAATTCT
TAAAACTCAGCTTCCAAGTATGAATGA


>TTHERM_00128280(protein)
MSNYKNQSSYSPISRQEGYEKDIIISQLKSEIWELKQQEREYSEIIAHNKNLEGQYQLLK
DEKFRIENELKQKNHEQIKQLANYRQRVDQLEQALTERKIEIQELRAENIAQREHCDHKQ
LEISRLKTEQIHLEDTITRLQNENISIKNELDDLRDYKRKVNSDMELLINTNDNLQSKTL
DQDKIIRSLDYEKIQQQRYVDSLKSQITQLENELINKSDNIKDVQNQVIDYKQQLVSLER
ALEDVEKLREKYKQESLHHQTCLKEEISKNFDLNQQILNLDSNLRSKVNFIDELKRQLDE
VKRDVTETLEQNDFISNELERYKRNFDIASAQNAELLRQLEQFNEQDEEIRHILDRKGQV
REIKTRVDNYLRQSQNDFRMVSPNNRSYLAASGKHNRRNSQNSASKYE


>TTHERM_00128280(gene)
ATGTCAAACTACAAAGTAAAAAATGTTAAAAATGAATTTAATGCTAATAAATAAAATTAT
ATTTTTATACTCATTTATTTTCTATAAAAATAATTAGAATCAATCATCTTACTCTCCAAT
TTCTAGATAGGAAGGATATGAAAAGGATATCATCATTTCTTAATTGAAATCAGAAATATG
GGAACTTAAGTAGCAAGAGCGTGAATATTCTGAAATCATCGCACATAACAAGAATCTTGA
AGGTTAGTACTAACTTTTGAAGGATGAGAAGGTATTTAAAATTAAATAAAATCTTTATCT
TGAACTATTAGAATCAATAGAGAGCTTTAAAAAATAACATTTGTTTTTTAGTTTGTTTTG
CTAATACAAAATAAAAAGCATTATTAAATAGCATATTGAAACTTATTTTAATTTTTTAGT
TCAGAATAGAAAATGAATTGAAGCAAAAGAATCATGAATAAATCAAGCAATTAGCTAACT
ACAGATAGCGCGTTGATTAGCTAGAATAAGCTTTAACTGAAAGAAAGATAGAAATTTAAG
AATTAAGAGCTGAAAATATTGCCTAAAGGGAGCATTGCGATCACAAGTAGCTTGAAATTT
CTAGACTTAAAACTGAATAAATCCACTTAGAGGATACTATAACTAGATTGTAGAATGAGA
ATATCTCAATTAAAAATGAATTAGATGATTTAAGAGATTACAAAAGAAAAGTCAACAGCG
ATATGGAATTACTTATCAACACAAACGATAATCTCCAAAGCAAGACCTTAGATTAAGACA
AGATTATTAGATCATTAGATTATGAAAAGATTTAACAATAGAGATATGTTGATTCTTTGA
AGAGTTAAATTACTTAGGTAACTATTTTTTTTAAAGCTATTTAGAAGATATTTTTATAAA
AATAATCAACATAGATAATTTTAAAATAAAATATGCTAATCTTTAAATGGAAATAAATGG
TTATTTTGTTAAAAACAGTTAGAAAATGAATTGATTAACAAGAGTGACAACATTAAAGAC
GTTTAAAATCAAGTAATTGATTACAAATAATAGTTGGTATCCTTAGAAAGAGCTTTAGAA
GATGTTGAAAAGCTTAGAGAAAAATATAAATAAGAGAGCCTTCATCACTAGACTTGTCTT
AAGGAAGAAATTAGCAAGAACTTTGATTTGAATTAGCAAATTCTTAACTTAGACAGCAAT
CTTAGGTAAAATTATAAATCACATTTATTAATTTTTCATCAAAAAATATATTTTTATAGG
AGCAAAGTCAACTTTATTGATGAATTGAAGCGTCAGTTAGACGAAGTAAAGAGAGACGTC
ACAGAAACCCTTGAATAAAACGATTTCATTTCCAATGAATTAGAAAGATATAAGAGAAAC
TTTGATATTGCCTCAGCCTAAAATGCTGAAGTAATTAATTAATTAAATTTAATTTGAATT
TTTAAATAATATCATTTTAACTGAATAGTTATTGAGATAATTAGAGCAATTCAATGAATA
AGATGAAGAAATAAGACATATTTTAGATAGAAAGGGATAAGTTAGAGAAATTAAAACAAG
AGTTGATAACTACTTGAGATAATCTTAAAATGACTTCAGAATGGTATCTCCAAACAACAG
GAGTTATCTTGCTGCCTCTGGTAAACATAACAGAAGAAATTCTTAAAACTCAGCTTCCAA
GTATGAATGA