Identifiers and Description

Gene Model Identifier

TTHERM_00128290

Standard Name

DFB1 (Deep Fibre Bundle)

Aliases

PreTt09393 | 9.m00414 | 3699.m00122

Description

Deep fibre bundle protein; localizes to deep fibre bundle of oral apparatus; forms filamentous structures; associates with basal bodies and longitudinal microtubules

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF04702 ) Vicilin N terminal region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00128290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21127172: Gould SB, Kraft LG, van Dooren GG, Goodman CD, Ford KL, Cassin AM, Bacic A, McFadden GI, Waller RF (2011) Ciliate pellicular proteome identifies novel protein families with characteristic repeat motifs that are common to alveolates. Molecular biology and evolution 28(3):1319-31

Sequences

>TTHERM_00128290(coding)
ATGAATCTGGATATTAATGAAGATAATCAATCATCTTACTCTCCAATTTCTAGATAGGAA
GGATATGAAAAGGATATCATCATTTCTTAATTGAAATCAGAAATATGGGAACTTAAGTAG
CAAGAGCGTGAATATTCTGAAATCATCGCACATAACAAGAATCTTGAAGGTTAGTACTAA
CTTTTGAAGGATGAGAAGTTCAGAATAGAAAATGAATTGAAGCAAAAGAATCATGAATAA
ATCAAGCAATTAGCTAACTACAGATAGCGCGTTGATTAGCTAGAATAAGCTTTAACTGAA
AGAAAGATAGAAATTTAAGAATTAAGAGCTGAAAATATTGCCTAAAGGGAGCATTGCGAT
CACAAGTAGCTTGAAATTTCTAGACTTAAAACTGAATAAATCCACTTAGAGGATACTATA
ACTAGATTGTAGAATGAGAATATCTCAATTAAAAATGAATTAGATGATTTAAGAGATTAC
AAAAGAAAAGTCAACAGCGATATGGAATTACTTATCAACACAAACGATAATCTCCAAAGC
AAGACCTTAGATTAAGACAAGATTATTAGATCATTAGATTATGAAAAGATTTAACAATAG
AGATATGTTGATTCTTTGAAGAGTTAAATTACTTAGTTAGAAAATGAATTGATTAACAAG
AGTGACAACATTAAAGACGTTTAAAATCAAGTAATTGATTACAAATAATAGTTGGTATCC
TTAGAAAGAGCTTTAGAAGATGTTGAAAAGCTTAGAGAAAAATATAAATAAGAGAGCCTT
CATCACTAGACTTGTCTTAAGGAAGAAATTAGCAAGAACTTTGATTTGAATTAGCAAATT
CTTAACTTAGACAGCAATCTTAGGAGCAAAGTCAACTTTATTGATGAATTGAAGCGTCAG
TTAGACGAAGTAAAGAGAGACGTCACAGAAACCCTTGAATAAAACGATTTCATTTCCAAT
GAATTAGAAAGATATAAGAGAAACTTTGATATTGCCTCAGCCTAAAATGCTGAATTATTG
AGATAATTAGAGCAATTCAATGAATAAGATGAAGAAATAAGACATATTTTAGATAGAAAG
GGATAAGTTAGAGAAATTAAAACAAGAGTTGATAACTACTTGAGATAATCTTAAAATGAC
TTCAGAATGGTATCTCCAAACAACAGGAGTTATCTTGCTGCCTCTGGTAAACATAACAGA
AGAAATTCTTAAAACTCAGCTTCCAAGTATGAATGA


>TTHERM_00128290(protein)
MNLDINEDNQSSYSPISRQEGYEKDIIISQLKSEIWELKQQEREYSEIIAHNKNLEGQYQ
LLKDEKFRIENELKQKNHEQIKQLANYRQRVDQLEQALTERKIEIQELRAENIAQREHCD
HKQLEISRLKTEQIHLEDTITRLQNENISIKNELDDLRDYKRKVNSDMELLINTNDNLQS
KTLDQDKIIRSLDYEKIQQQRYVDSLKSQITQLENELINKSDNIKDVQNQVIDYKQQLVS
LERALEDVEKLREKYKQESLHHQTCLKEEISKNFDLNQQILNLDSNLRSKVNFIDELKRQ
LDEVKRDVTETLEQNDFISNELERYKRNFDIASAQNAELLRQLEQFNEQDEEIRHILDRK
GQVREIKTRVDNYLRQSQNDFRMVSPNNRSYLAASGKHNRRNSQNSASKYE


>TTHERM_00128290(gene)
ATGAATCTGGATATTAATGAAGATGTAGATTCTCAGCTTGAAATAGATTTGTTAAATTCT
ATTAAAAAACTTGAAAGACTCTAAATTTTAGTGCTATATTTAAATAAGAATTACAAAATA
CATAATAATAGATTCAAATCAAAATTTACTTCAAATGATGAGAAATAAAAATAAAAAGAA
TTCTTTTACAAATCTTATAAAGATATGAATTAAAATAAAGTTTTAAGCTCGATTATAAAT
TTAAATTTTCTTTAAAATCCTTAATTTTTATTTTCACTATCTTAAGTTTCAGAAGATTTC
TTAAATGGTTTAAACAATTTTGCTTAGTAAGCGAAATTCAATTATTAAATAACCCTACAA
TCATAATATTAATTTGAGAGATCTTGGTAAAACGAAGAATATAAAAACCCTAATGCAATA
AGTTTGGGATATTTGAAATAAATTGTAAATATCGTAAGGTTTTATAAAAAAGTTAAAACA
ATAAAAACAAATCTCAGAATTAGGTTTTTTTTTAAAAAAAGTAGTGTAGATTAAAAATCA
AGAGAGTAATTTAGCATTTAGAAAAGTTAAAATGAGTTTAAATTAAACTCTTACTTAAAA
ATATATCCAAACTTAGATTTTGATTATTTCTATAAATAATTTGAAGATAACTTTATTTAA
TTAGGAAGTGTTTCTTAAATTAGAATAATTTATTACAGCGATCCAGACTTTTCTTTTACT
TTTTTAAAGGTTTTTTAAAATATTTAAACTATTGAAATATTAGAAATAAAATTTCATTAT
TCAAACGAATATTTAACATATGAACAATATAGCTAGTTTATTTAAATTTTATTCAACATA
AAAAGAATACTTTTTATCATATTTGAATATCCTTTTCGTATTTAATATACTAAGAAGATA
AGATAATAAATATTAAAAATACCTGCTTTAGTAAAGATTAGTATCAAAAATAATGCAATT
GATAGTGAAATGGAAGATTTTTTTTATAGTCAAAAAATTCATTGGTCAGATTCTTCATTT
TGAACCAAAAAGAGGACTTAGAAAATGAACAGAACAGATGAGTGAATGAATTTTTTCTTT
CTTATTTATGTATTCATTTTAAGAAAATAAATTGAATGCATGCTAATATATTTTACTCGA
TTAAATTATATTAAAAAAATTACTAAAATCTTGAACAAATTTAGTTTGTATATTTATTTG
GGAAAAGTAACATTATGAATATCTAGAAATCGGGCAATATTAAATATTTCTATCTACTTA
CATCTAATATAAAATTTTATGAAAAATTATTAATTAATTTATTAAATCAATCATTTATTT
ATTTAGAAAAATTTTTCAGTTTTAAATAATTATTTTACAATTGCTAAATATATATTTATT
TATTGTACTGTATTGTTTATTTTAGGCCTCAAATATAAAACATAGATCGTTTTTCACAAA
TTTTTTTTAGCCAATTTAATTAAAAATGTTTCTATCTTTACAAATTTAAATATAAAATAT
AAACTACAATAAAAAAATTTATTTGAAATATATTTAAATTGTAAGTTAATTTATTTTTTC
TGTATTAATTATCAATTTATCTAATTAATTAAGATAGTTAAATATTTTAATAATGTACAT
AATAAATTATAAATCAATCATTATTCTTATTAAGATCTGAAAAGAGTATAATTTAAAGTA
TTTTGATCATTCAATAAATTCAAAATTTCTAAGAATTCATTTAATCTTTCTTCATCTGGA
TAATAATTATTATCATAAATATAACCTAAGAAACTTCCTAATTAATTAATATCGTTTGTA
TGGTAATATTCTCCAAAATTAAAAATTAAATATTTCCAAATTTATACTAATGTAAATGTT
GACTCAATAAACTCTTTGGAAATTGTATTTTCTACTTTTTCTTATTTTTAGAGAAAATCT
ATTAAACACCTTGATTAAAGGATGGCATAAATAATATCATATATTTCTGTTTTGTTAATT
TCAATACTTTGATATAAAATATTCATTATTTTTATAATAATTTAAAATGAGTCTTCTGAC
AAAATTCTTATTTTAAGTTTTTCTTTATGAAAAAGTTTGTGAACAAATGGTAAAATTTTT
TAAAATTCATATTGCTCAAAAATAATTTATAAAATATTTAGCCTTATTTCATCTTCATCC
TACTTTTAATAATATAATATTAAAATTTATTTTAAATATAATTAAAATTCAATTTACATT
TGGTCTTCCTTATTCATTTTATCTGTTAACTGAATTATTTAAAATTTTAAGGTTAATATT
AAAGAATTATTCAGGTTCAATTACTGAAAATAAGCACTTATGTTTAATTTTATATATTTC
TTATTATTAATTTAAATTCTAAATAACAAAAGGAATATTTTAATTTTTTTCATTTTAATT
AAAATTATTATCATTGGAATCACCTCTCTTATTATTTACTTGTTACTATTTATTATTCAA
AACTTAAATTTATTAAAGGTTTTATTGTTGATTATTTTAGTTAAAACCATATATTTTGTT
AGAGTTAAAATAATGTTAACCCGTTAAGGCTAATTGTTATTATTGTTATTGTACTTCTTG
AATATGTTAATCATTTTAATTAATTTGTTGATTCTATGCAAATTTTAATTTATTTTAGTT
ATAGTCTTACTCTTAGTTATTTTGATAGATATGCTATTGTTAATTTAAACCATTATTCAT
TTGGTTATTAAATCCTATTTACTAGTTGGTATTCTTCCCATAGTTATTAGATGGCTCAAA
TTTGTTCGAATTAATATTAGGCATATTGACATTTTAGTTTAGATTCATATTGTTAAAATT
AAAATCCTATTAATTATCACAGGCTAATTGCTATTTATATTATTGTTGTTATTATTAAGG
ATTTTAAAATGATTCAAAATTGTCATATTATTAGGTTAAATATCTTGGTCTTTGATGATA
AATTTATTAATTATTAATTAATTAATTCTATGCAAATTTCAAATTATTTTAGTTATTGTT
TTACTGTTAGTTGTTTTGATATATATGCTATTGTTAATTAACACCTTTATTTATTTGATT
ATCAAATCCAACTTACTAGTTCATATTTTTGTCATAGTTATTATATGGCTCAAATTTGTT
CAAATTCATATCAGGTAAATTGGCATTTTAGTTAACATTCATATTGTTTTAATTAAAATT
CTATTAATTATCACAGACTAATTGCTATTAAAATTATTGTTCTTATTAAAGATTTTAAAA
TGATTCACAATTTTAAAAATTGCCATACTATTAGGTAAAGTATCTTGGTTTTTATTGATA
AATTTATTAATTATTAATTAATTGATTCTATTAAAATTTCAAATTATTTTATTTATTATT
TTACTCTTAGTTATTTTGATAGATATGCTATTGTTAATTTAAACCATTATTCATTTGGCT
ATTAAATCCGACTAACTAGTTGGTATTTTTGCTATAGTTATTAGATGGCTCAACTTTGTT
CAAATTTATATTAGGCATATTGACATTTTAGTTAAGATTCATATTGTTTAAATTAAAATT
CTATTAATTATCACATGCTAATTGCTATTAATATTATTGTTCTTATTATTAAAATTATTC
ACAATTTTATAAATTATCTTATTATTAGGTAAAATATTTTGGTCTTTGATAATAAATTTA
TTAATTATTAATTAGTTGATTCTATACAAATTTCTAATTATTTTAGTTATTGTTTTACTC
TTAGTTATTTTGAAAGAAATACTATTGTTAATTTACACCATTATTCATCTAGTTATTATT
TCCGACTTGCTAGTTGATATTTTTGCCATAGTTATTAGATGTCTCGAATTTGTTCTAATT
AGATATATTGACGTTTTAGTTAATATTCATGTTGTTTAAATTAAAATTCTATTAATTATC
ACCTGCTAATTGTTATTAAAATTATTGTTCTTATTATTAAAAATTTTAAAATTATTCACA
ATTTTTATAATCTTCATAATTTTAGGTAAAATATCTTGGTCGTTGATGATAAATTTATTA
ATTATTAATTAGTTGATTCTATGCAAATTTCAAATTATTCTAATTGATGTACTACTACTA
TTCTTAATCACTTTAATATTCTTAATTAGCATTGTTAATCACTTTCTAGTTAGCTACGAG
TTATTACTATGTATTGTTATTATAGTTGTTAGGTTATTCAAATGTATTAGAATTAAAATT
AAGATTTTAGTTAAGATTCATATTTTATGAATTAGAATTGTATTAATTACCAAAGGCTAA
CTGTTATTGTTATGAATAAACTTGTTAATCATTTTTTAAATTTTCTAAATTATTGTATTA
TTAGGTAAAATATCTTGGCCTATGATTTTAAATTTATTAATTATTAAAATATTTCAAATT
ATTTTAATTATTTTTTTATTCTTCATTCTATTGATATTCATGTTATTGCTAATTAATATT
ATTATTATTCATTTAGTTATTAAATGTAGCCTGCTAATCGGTTTATTTAATATAGATTTT
AGGTAATTGTAATTTAATTTTTAACAATTCATTGCATTAATTTTAGATATTTTTTTAACT
CAATTAATTAATTTTTGTTGATTACTTTAATTATCCCTGCAAGTTAATGTTGGTTGCTAA
GTACTCCAATTATTCTTTGTTAAAATTTATTTATTTGATGGCTGTTAAGCTTAGAATTAT
TATTTTGTCAAATTTAATTATTTTTTATTGTTTTATTATTATTCTAAATCAATTAATTCT
TCATTATCTTAAAATTAATTATTTTAAATTTGTTAGTCTTAATCAGGTTATGGCGTAACT
TCAAATATTTTAGTTTATTTTTTTAATTATTAATCATTTTATGATTGTATTTAAATATTT
TCAAATTGTTGCTAAATTTCACCATTAATATCCTAATTATTATTTTAAGTAATTTATATT
TTACAATCCTAATTAAATTTCTGCTCAGATTATTTTTGAAAATGATCTTATTATTGCTAT
TATTTTTAATCTATTTGTAAATCTTGATTTTTTATCAGATTTACATTCTAATTATTTTGA
ATTAATTCTTGATTTTGATTGAATTACAAATTATTATTTTACACAAACTCAAATTAACAA
GATAAAAATGCTGGTTTTTAAATCTACTTTTAAAATTGCTTTTATGAATTCATTTAAAAT
TGGCTCTAACTTTAGCTACCAATATTGTTATTATTATATCCAAAATAATTTATTTATTCT
TAATTTCGCTATATCTAAGTATTTTGTTAGCCTAATTTATTTAGATCATTTAAATGATCA
TCATTGTTAGGTAAATATATTCCTTCCTAGTTTTAAAAATTTTATTATTTCAAACCAAAG
AAATTCTTTTAGCTTTAACTCATGCTGATCCTGATTAAATGTTTTCTTATGATAACTAAT
TTAGATAATCTAATGATGAAATTTAATGGCACAAAATAGAATTCTTCAGGTTAATTTTTA
ATGAAAAAATCTTTCTAATTTTATAAATTTGCAAAAAGTTTTTAATATTTTGGTTATCTT
TGCTAATGATTTACTAAGTATTTTTGTTTTGGTTGAATGCTTATGACCTATTTAAATGAA
AATAAATTGCGAAGCGACTCTTTTGTAATATGTCTTAAAAATAATCAACTAAAAGGATTG
TTTTTGTTTTTTATATATTTCTAGATTTAAAGTTAAATAAACTATTTTTGTAAGTAAATA
TTTATTATTACTAATTAAATTCACTAGATAACTTAACTCTACTTATAAAAAATTGTATTT
AGAGTGTCAATAATCAAATAGAAATTAAATATTCATAGTAATAAAATACTTTTATTAATA
TACTTAATTATTTTTACCTAAATATGAAGTAAAGTTTTATAAAAATAAAAATATAACAAA
CATTCCTAATATTTTTATGTAAAAATATTAAAAAAATGGAAGAAAAAAGTAAATTGTTTA
TAAAAAAAGAGAAATAGATGAACTGAAACCTGACAGAATAAAATTTTAAATAAATTAAAA
ATCAAGATTTTAAATAATTTTTTAAAATTAAATTTTGAAAATATTTTTTTGTTTGTTAAA
TATTTATGTGCTGAAATAACTTTTAATTGTTAAAATAATAAAAATTTATTTATCAAATAA
TCATTTTTTTGAAAGAAATTTTCGCTATTGCAATGGATAATAAAAATAATTAAATCATGA
GCTGACCCAAATATGTTAATTCGTTTGACACCAATGTTAGATATGGAAATAAATTTTATT
GTGAGATGTTTTTGTGAAATAAAATACCTATTAAAAATAAATAAGAAAGAAGATGAAGGA
TGGTAAAGATATATTTCGTTATAATAATTACAAACAAACTTATTAATAAATTAATAAAAG
AAACATTTTCAAATCACTGAATATTATTAACTATAATATAAAAGCAATCAATCAATCAAT
AACTTTTAGAAGAAATGTCAAACTACAAAGTAAAAAATGTTAAAAATGAATTTAATGCTA
ATAAATAAAATTATATTTTTATACTCATTTATTTTCTATAAAAATAATTAGAATCAATCA
TCTTACTCTCCAATTTCTAGATAGGAAGGATATGAAAAGGATATCATCATTTCTTAATTG
AAATCAGAAATATGGGAACTTAAGTAGCAAGAGCGTGAATATTCTGAAATCATCGCACAT
AACAAGAATCTTGAAGGTTAGTACTAACTTTTGAAGGATGAGAAGGTATTTAAAATTAAA
TAAAATCTTTATCTTGAACTATTAGAATCAATAGAGAGCTTTAAAAAATAACATTTGTTT
TTTAGTTTGTTTTGCTAATACAAAATAAAAAGCATTATTAAATAGCATATTGAAACTTAT
TTTAATTTTTTAGTTCAGAATAGAAAATGAATTGAAGCAAAAGAATCATGAATAAATCAA
GCAATTAGCTAACTACAGATAGCGCGTTGATTAGCTAGAATAAGCTTTAACTGAAAGAAA
GATAGAAATTTAAGAATTAAGAGCTGAAAATATTGCCTAAAGGGAGCATTGCGATCACAA
GTAGCTTGAAATTTCTAGACTTAAAACTGAATAAATCCACTTAGAGGATACTATAACTAG
ATTGTAGAATGAGAATATCTCAATTAAAAATGAATTAGATGATTTAAGAGATTACAAAAG
AAAAGTCAACAGCGATATGGAATTACTTATCAACACAAACGATAATCTCCAAAGCAAGAC
CTTAGATTAAGACAAGATTATTAGATCATTAGATTATGAAAAGATTTAACAATAGAGATA
TGTTGATTCTTTGAAGAGTTAAATTACTTAGGTAACTATTTTTTTTAAAGCTATTTAGAA
GATATTTTTATAAAAATAATCAACATAGATAATTTTAAAATAAAATATGCTAATCTTTAA
ATGGAAATAAATGGTTATTTTGTTAAAAACAGTTAGAAAATGAATTGATTAACAAGAGTG
ACAACATTAAAGACGTTTAAAATCAAGTAATTGATTACAAATAATAGTTGGTATCCTTAG
AAAGAGCTTTAGAAGATGTTGAAAAGCTTAGAGAAAAATATAAATAAGAGAGCCTTCATC
ACTAGACTTGTCTTAAGGAAGAAATTAGCAAGAACTTTGATTTGAATTAGCAAATTCTTA
ACTTAGACAGCAATCTTAGGTAAAATTATAAATCACATTTATTAATTTTTCATCAAAAAA
TATATTTTTATAGGAGCAAAGTCAACTTTATTGATGAATTGAAGCGTCAGTTAGACGAAG
TAAAGAGAGACGTCACAGAAACCCTTGAATAAAACGATTTCATTTCCAATGAATTAGAAA
GATATAAGAGAAACTTTGATATTGCCTCAGCCTAAAATGCTGAAGTAATTAATTAATTAA
ATTTAATTTGAATTTTTAAATAATATCATTTTAACTGAATAGTTATTGAGATAATTAGAG
CAATTCAATGAATAAGATGAAGAAATAAGACATATTTTAGATAGAAAGGGATAAGTTAGA
GAAATTAAAACAAGAGTTGATAACTACTTGAGATAATCTTAAAATGACTTCAGAATGGTA
TCTCCAAACAACAGGAGTTATCTTGCTGCCTCTGGTAAACATAACAGAAGAAATTCTTAA
AACTCAGCTTCCAAGTATGAATGA