Identifiers and Description

Gene Model Identifier

TTHERM_00664030

Standard Name

DESI1 (DeSumoylating Isopeptidase 1)

Aliases

PreTt23850 | 98.m00193 | 3736.m00091 | LC3A

Description

SUMO-specific protease; deSUMOylase; removes Smt3p from protein substrates; Desi1p is distinct from the Sentrin-specific proteases (SENP) family of deSUMOylases

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00085 ) Thioredoxin
  • ( TIGR01068 ) thioredoxin
  • ( TIGR01126 ) protein disulfide-isomerase domain
  • ( TIGR02196 ) Glutaredoxin-like protein, YruB-family
  • ( PF05903 ) Eukaryotic protein of unknown function
  • ( TIGR00385 ) periplasmic protein thiol:disulfide oxidoreductases, DsbE

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00664030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17191.19.997093137033517e-262thioredoxin family protein (32
5 aa)
DictyBaseDDB_G02928867.998505003885351e-50DDB_G0292886 on chromosome: 6
position 2214235 to 2215853
OxytrichaContig17686.0.g391.999534248571833e-46PPPDE putative peptidase domai
n
Stentor CoeruleusSteCoe_205937.095474162284704e-23
WormBaseWBGene000219331.999598840915195e-17status:Partially_confirmed U
niProt:Q9N357 protein_id:CCD
67239.1
SGDYCR083W0.000000000000004001928599951003TRX3 Mitochondrial thioredoxin
, highly conserved oxidoreduct
ase required to maintain the r
edox homeostasis of the cell,
forms the mitochondrial thiore
doxin system with Trr2p, redox
state is maintained by both T
rr2p and Glr1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00664030(coding)
ATGGCTGAACAAAAGCATAGGGTAGTAGTTAATTTGTATGATTTATCTGGAGGTATGGCT
AGAGTTTTCTCTCCCATGTTCCTTTAGAAACAAATTGATGGAATTTGGCACACTGGTTGT
GTTGTTTACGGTAAGGAATTTTATTTTGGTGGAGGCATCTGCTCTGGCTTACCAAAATAG
ACACCTTACGGAACACCAGTTTAGTAAATAGATGTTGGAGAGACTGAAGTTCCTGAAGAA
GTCTTTACAGAGTTTTTGAGAGATATTTCAGATAGATTTACTATGGATAAATATGACTTA
TTTAAAAATAATTGCAACAACTTTACTGATGAATGTACTCATTTCCTAACAGGATAACAT
ATTCCTGAGTATATAACAGGTTTACCTGATGAAGTATTAAATACTCCTATGGGTCAAATG
ATAAAACCTCTTGTTGATCAAATGCAATAATCCGTTGTAAATGCAAGTGGTTAATCAGCA
CTATTCCCAGCTTAGTTTGAAGGTGTTAATAATCCTCAATAAATGTTTGGAAATAATTAA
CAATAATAATAATAATAGCAATAGGCACCTATTTTCCCTAATGGTATAAATAATACAGAT
ATCCTCAATAAATTTACTTAGTTGAATAATAACTAACCAGTTGATATGAAGAAAGTTGAA
GAAGCAACTGATTTAATGGATTACTTTACTAAGGTAGAGGGACAAAAAGCAGTGATTATC
GACTTTAACGCTGATTGGTGTGGACCTTGTTAAGTAATCAAGCCAATATTTGCTTAATAT
AGTGAAGAATACCCAAATATCAAATTTATTTCTGTAAATACAGAAAAAAACAAGGAGGTT
GCCCAATAATTTGGCATTTAATCTCTCCCCACCTTCATCACCCTTCATGAAGGTGAAATA
TCTGCAACTTGGAAAGGAGCTAATCAAGTAAACTTAAAAAATAACCTTGATAAATTAGCA
GAAAAGCTTAAATGA


>TTHERM_00664030(protein)
MAEQKHRVVVNLYDLSGGMARVFSPMFLQKQIDGIWHTGCVVYGKEFYFGGGICSGLPKQ
TPYGTPVQQIDVGETEVPEEVFTEFLRDISDRFTMDKYDLFKNNCNNFTDECTHFLTGQH
IPEYITGLPDEVLNTPMGQMIKPLVDQMQQSVVNASGQSALFPAQFEGVNNPQQMFGNNQ
QQQQQQQQAPIFPNGINNTDILNKFTQLNNNQPVDMKKVEEATDLMDYFTKVEGQKAVII
DFNADWCGPCQVIKPIFAQYSEEYPNIKFISVNTEKNKEVAQQFGIQSLPTFITLHEGEI
SATWKGANQVNLKNNLDKLAEKLK


>TTHERM_00664030(gene)
ATGGCTGAACAAAAGCATAGGGTAGTAGTTAATTTGTATGATTTATCTGGAGGTATGGCT
AGAGTTTTCTCTCCCATGTTCCTTTAGAAACAAATTGATGGAATTTGGCACACTGGTTGT
GTTGTTTACGGTAAGGAATTTTATTTTGGTGGAGGCATCTGCTCTGGCTTACCAAAATAG
ACACCTTACGGAACACCAGTTTAGTAAATAGATGTTGGAGAGACTGAAGTTCCTGAAGAA
GTCTTTACAGAGTTTTTGAGAGATATTTCAGATAGATTTACTATGGATAAATATGACTTA
TTTAAAAATAATTGCAACAACTTTACTGATGAATGTACTCATTTCCTAACAGGATAACAT
ATTCCTGAGTATATAACAGGTTTACCTGATGAAGTATTAAATACTCCTATGGGTCAAATG
ATAAAACCTCTTGTTGATCAAATGCAATAATCCGTTGTAAATGCAAGTGGTTAATCAGCA
CTATTCCCAGCTTAGTTTGAAGGTGTTAATAATCCTCAATAAATGTTTGGAAATAATTAA
CAATAATAATAATAATAGCAATAGGCACCTATTTTCCCTAATGGTATAAATAATACAGAT
ATCCTCAATAAATTTACTTAGTTGAATAATAACTAACCAGTTGATATGAAGAAAGTTGAA
GAAGCAACTGATTTAATGGATTACTTTACTAAGGTAGAGGGACAAAAAGCAGTGATTATC
GACTTTAACGCTGATTGGTGTGGACCTTGTTAAGTAATCAAGCCAATATTTGCTTAATAT
AGTGAAGAATACCCAAATATCAAATTTATTTCTGTAAATACAGAAAAAAACAAGGAGGTT
GCCCAATAATTTGGCATTTAATCTCTCCCCACCTTCATCACCCTTCATGAAGGTGAAATA
TCTGCAACTTGGAAAGGAGCTAATCAAGTAAACTTAAAAAATAACCTTGATAAATTAGCA
GAAAAGCTTAAATGA