Identifiers and Description

Gene Model Identifier

TTHERM_00310640

Standard Name

DES7 (C-7(8) sterol desaturase)

Aliases

PreTt21365 | 29.m00326 | 3696.m00144

Description

Rieske monooxygenase highly conserved in animals is the sterol-C7 desaturase; Catalyzes the introduction of a C-7(8) double bond into cholesterol and other sterols

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00355 ) Rieske [2Fe-2S] domain
  • ( TIGR02378 ) nitrite reductase [NAD(P)H], small subunit
  • ( TIGR02377 ) Rieske [2Fe-2S] domain protein, MocE

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00310640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18551.19.997093137033517e-262hypothetical protein (454 aa)
WormBaseWBGene000075365.001531130907917e-44locus:daf-36 Cholesterol des
aturase daf-36 status:Partia
lly_confirmed UniProt:Q17938
protein_id:CAA98235.2
Stentor CoeruleusSteCoe_361773.0144087850653746e-40

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00310640(coding)
ATGATTGAGTTCAACAAAGAATGTCTTATGGACATCCTTAAAAATCAAGATTACCATTTT
TATATGGTCATTCCTTTGATTTTCATAGGTCTCTACGCACTTTATATTAAAAAATTCAAA
TACTACAATCCTATTGAAAAGCAAGAATGGGATGATAGACGCTCTAACGTCAAGAGAGGT
AACCCACCTCCAAGCTATCCTAATGGTTGGTTCAGAGTTTGTCACAAAAATGAACTCTAA
ATTGGTCAATCTAAGTTCTTCAAGCTTAATGGTCGTCACATCACTGTTTTCCGCGGTGAA
GATGGTATCCCTTATGCTTTACATGCTTACTGCTCTCATATGGGTGCAAATCTCGGTATT
GGAGGTAAAGTTAAATGGAACTCTTGTATTGAATGTCCTTTCCATGGATGGTCTTTCGAC
GGTAAATCAGGTAAATGTGTTAACTCTGAACATTTAGATGAGAAGTAATGTACCCACCAC
ACCTATCACGACATCAAGAAAATGACCAAGGGTTCTGACAACAGATACATTAAAACATGC
GAATCTGGTTCTCCTTCCTAAATCTAAAAATTCCATGTCCGTCAATAAAACAATTTAATT
TATGTCTGGTTCCATGCTAAAAACGTCGACCCTTACTATGAACCTTTTGAAATTAATGAA
ATTCCTTATCTTGAAGATAGAGGTGAAACTGCCGACTATGTTAATTGCTAAATCCAAGAA
ATCCCTGAAAACGGAGCTGATTTCAAGCACTTTGAATACGTTCACTACGCTTGGATCGAA
ATACTTTTCCCATGGATTAAATTCAAGTGGGTTCCTAAGGATCGTAAACCAACTGATAAG
GACTTCGATGAAGTAATGAGAACTCACCCCAACAAAAAGGTTCAAGCCTTTTCAAACAAG
CTCTTCGACAAGTACACTAACGAATAAAATAAAACTCACATCAATAACCTCGTCTTGGAT
GCCTATCTTGTCTTCTTTGATAAATTTGAATTCTACATCTAAACTGCAACAGTCTTCTAA
TTAGGTTCCGGTACTGTATTTTTATTCTTGAAATTCCCCTTATGGGAAGCTGTTGTTGTC
TAGAGTGTTACTCCTGTTGGAAAGTTCAATTAACTTGTTCACCACAAGATGTACACTTCC
TGGTGGTTACCTTACTGGGTCTCTGCTTATCTCCTAGCTGGTTTTAGAAAGTAATTCATT
TCTGACAAAATTGTCTGGAATAACAAAATTTTTGCTGACAAGCTTACATACAATCCTAAA
GCTGTATTTGATGAGAGACTCCTCAACTGGAGAGAATGGTATTCTCAGTACTACGAAGGC
TGCGATGAATTCGAAAAGAACCAAGAAGCTTTTGACTGGTGA


>TTHERM_00310640(protein)
MIEFNKECLMDILKNQDYHFYMVIPLIFIGLYALYIKKFKYYNPIEKQEWDDRRSNVKRG
NPPPSYPNGWFRVCHKNELQIGQSKFFKLNGRHITVFRGEDGIPYALHAYCSHMGANLGI
GGKVKWNSCIECPFHGWSFDGKSGKCVNSEHLDEKQCTHHTYHDIKKMTKGSDNRYIKTC
ESGSPSQIQKFHVRQQNNLIYVWFHAKNVDPYYEPFEINEIPYLEDRGETADYVNCQIQE
IPENGADFKHFEYVHYAWIEILFPWIKFKWVPKDRKPTDKDFDEVMRTHPNKKVQAFSNK
LFDKYTNEQNKTHINNLVLDAYLVFFDKFEFYIQTATVFQLGSGTVFLFLKFPLWEAVVV
QSVTPVGKFNQLVHHKMYTSWWLPYWVSAYLLAGFRKQFISDKIVWNNKIFADKLTYNPK
AVFDERLLNWREWYSQYYEGCDEFEKNQEAFDW


>TTHERM_00310640(gene)
ATAAAATAAAAATTAGACTTTTACAAGATCTAAGAAAAATTAAAAAGAAGTAAAGTACAA
ACTAATATCTTTTTAAGTTCTATCTATAGGTTTAAAAGCACTAAGTAAATAGAAGAAGTT
TATACTAAAATTAATTATAATTTGCCATAAATGATTGAGTTCAACAAAGAATGTCTTATG
GACATCCTTAAAAATCAAGATTACCATTTTTATATGGTCATTCCTTTGATTTTCATAGGT
CTCTACGCACTTTATATTAAAAAATTCAAATACTACAATCCTATTGAAAAGCAAGAATGG
GATGATAGACGCTCTAACGTCAAGAGAGGTAACCCACCTCCAAGCTATCCTAATGGTTGG
TTCAGAGTTTGTCACAAAAATGAACTCTAAATTGGTCAATCTAAGTTCTTCAAGCTTAAT
GGTCGTCACATCACTGTTTTCCGCGGTGAAGATGGTATCCCTTATGCTTTACATGCTTAC
TGCTCTCATATGGGTGCAAATCTCGGTATTGGAGGTAAAGTTAAATGGAACTCTTGTATT
GAATGTCCTTTCCATGGATGGTCTTTCGACGGTAAATCAGGTAAATGTGTTAACTCTGAA
CATTTAGATGAGAAGTAATGTACCCACCACACCTATCACGACATCAAGAAAATGACCAAG
GGTTCTGACAACAGATACATTAAAACATGCGAATCTGGTTCTCCTTCCTAAATCTAAAAA
TTCCATGTCCGTCAATAAAACAATTTAATTTATGTCTGGTTCCATGCTAAAAACGTCGAC
CCTTACTATGAACCTTTTGAAATTAATGAAATTCCTTATCTTGAAGATAGAGGTGAAACT
GCCGACTATGTTAATTGCTAAATCCAAGAAATCCCTGAAAACGGAGCTGATTTCAAGCAC
TTTGAATACGTTCACTACGCTTGGATCGAAATACTTTTCCCATGGATTAAATTCAAGTGG
GTTCCTAAGGATCGTAAACCAACTGATAAGGACTTCGATGAAGTAATGAGAACTCACCCC
AACAAAAAGGTTCAAGCCTTTTCAAACAAGCTCTTCGACAAGTACACTAACGAATAAAAT
AAAACTCACATCAATAACCTCGTCTTGGATGCCTATCTTGTCTTCTTTGATAAATTTGAA
TTCTACATCTAAACTGCAACAGTCTTCTAATTAGGTTCCGGTACTGTATTTTTATTCTTG
AAATTCCCCTTATGGGAAGCTGTTGTTGTCTAGAGTGTTACTCCTGTTGGAAAGTTCAAT
TAACTTGTTCACCACAAGATGTACACTTCCTGGTGGTTACCTTACTGGGTCTCTGCTTAT
CTCCTAGCTGGTTTTAGAAAGTAATTCATTTCTGACAAAATTGTCTGGAATAACAAAATT
TTTGCTGACAAGCTTACATACAATCCTAAAGCTGTATTTGATGAGAGACTCCTCAACTGG
AGAGAATGGTATTCTCAGTACTACGAAGGCTGCGATGAATTCGAAAAGAACCAAGAAGCT
TTTGACTGGTGA