Identifiers and Description

Gene Model Identifier

TTHERM_01194720

Standard Name

DES5 (C-5(6) Sterol Desaturase )

Aliases

PreTt07509 | 270.m00035

Description

Catalyzes the introduction of a C-5(6) double bond into lathosterol and cholestanol (Nusblat, et al. 2009)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01194720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21011.19.997093137033517e-262sterol desaturase (335 aa)
Stentor CoeruleusSteCoe_106472.2856936767186716e-49
SGDYLR056W5.9971655715910366e-21ERG3 C-5 sterol desaturase, ca
talyzes the introduction of a
C-5(6) double bond into episte
rol, a precursor in ergosterol
biosynthesis; mutants are via
ble, but cannot grow on non-fe
rmentable carbon sources
OxytrichaContig18492.0.g710.000000030002053728821195Fatty acid hydroxylase superfa
mily
DictyBaseDDB_G02796110.00010003404299092957DDB_G0279611 on chromosome: 3
position 2316340 to 2317367

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19525418: Nusblat AD, Najle SR, Tomazic ML, Uttaro AD, Nudel CB (2009) C-5(6) sterol desaturase from tetrahymena thermophila: Gene identification and knockout, sequence analysis, and comparison to other C-5(6) sterol desaturases. Eukaryotic cell 8(8):1287-97

Sequences

>TTHERM_01194720(coding)
ATGTTACAATTATAATTTTAAAATTCTTATTTAATTTATTGTTTGTTTTTGGGAAAGTAT
AATAAATAATTTACTATATTAATCGTGCTAAATGGATTAAAGATACATACATAAATAAAT
ATCAATCTTTAATAAAAATAAATAACAATAGCTTAAAGGCTAAATCAAGTTGAATAAATT
CAAGAAAAAAAATAAATTAAGTCCTCAATGGTTTATTGGCTTATTGCTGAATAGTTAGGT
TATTTTAATGTAGATAGAGTTAAGGTGATGCAAGATGCCAAGGATCACATTAGCTCTTCA
CTCAGATTGATTTAATTAGATAAATTATTCCCTACTTTCTCAAATTTTATTCTAGATTCT
GCTGGTTAATAAATTGGTAACATAATTATAGAATATATTTGCACTCTGATTCATACTATA
GTTTTCGCTTACATCCTCTACTTCACTGCAGCTACATCCTCCTACTTTTATTTCTTTGTG
TACAAGAAAAAGAAATATTTGCCTGAATTTAAAGGAGATTTAAAAATTGCATTTGATATC
AAATGGTCTTGTATTAACATTTTTGTTGAATCATTTTTAGTATCTGCATTAAGATTAGCT
ATGCCCAGATTCTCTATGATCTACTATGATATCAATGATCATAGTTGGCTCTACATCCCT
TTTAGCATTTTATTTCATATGATGTTTGATGAAACCCTAACTTACTGGGTTCATAGATGG
CTCCACACCTTCCCTTATTTATATACCAAATTGCATGTAGTTCATCATAGATCAAAAGAT
GTTACACCCTTCTCTGGCTTTGCTTTCCACCCACTTGATGCTTTTGCCTAAGCTGTCCCC
ACTTTTGTAAGCTGTTATTTCTTCCCTCTCCATATTAACATCTTGCTTGGATTCTCATTA
ATTACCACAATCTGGGCCATTTCTATTCACGATAATGTTCCTCTAGTGCCTTGCAAGCTC
TTTTTGTACAGTACCCACCATTCTATCCACCACGAAGCTGGAAGAGGTTAAATGACTAAC
TATGGTAAATTTACTTCTGTATGGGACAGAATATGTTAAACTTACTGGGATCCTGACAGG
GTTTATTTTGGATGGGATGAATGGAAATAAAGAAAAGGAATATTCAGTAAATTCAATAGC
TTTTATAGCAAAATAGTACCTGATAAAAGCTCAGAAGAACTAAACAAATAAATTAAACAA
AAAAAGAATTGA


>TTHERM_01194720(protein)
MLQLQFQNSYLIYCLFLGKYNKQFTILIVLNGLKIHTQININLQQKQITIAQRLNQVEQI
QEKKQIKSSMVYWLIAEQLGYFNVDRVKVMQDAKDHISSSLRLIQLDKLFPTFSNFILDS
AGQQIGNIIIEYICTLIHTIVFAYILYFTAATSSYFYFFVYKKKKYLPEFKGDLKIAFDI
KWSCINIFVESFLVSALRLAMPRFSMIYYDINDHSWLYIPFSILFHMMFDETLTYWVHRW
LHTFPYLYTKLHVVHHRSKDVTPFSGFAFHPLDAFAQAVPTFVSCYFFPLHINILLGFSL
ITTIWAISIHDNVPLVPCKLFLYSTHHSIHHEAGRGQMTNYGKFTSVWDRICQTYWDPDR
VYFGWDEWKQRKGIFSKFNSFYSKIVPDKSSEELNKQIKQKKN


>TTHERM_01194720(gene)
ATGTTACAATTATAATTTTAAAATTCTTATTTAATTTATTGTTTGTTTTTGGGAAAGTAT
AATAAATAATTTACTATATTAATCGTGCTAAATGGATTAAAGATACATACATAAATAAAT
ATCAATCTTTAATAAAAATAAATAACAATAGCTTAAAGGCTAAATCAAGTTGAATAAATT
CAAGAAAAGTAAAACAAGATTTATATATAATATTATTATTTAAAATAGAACTATCATAAA
ATATTATTAGAAAATAAATTAAGTCCTCAATGGTTTATTGGCTTATTGCTGAATAGTTAG
GTTATTTTAATGTAGATAGAGTTAAGGTGATGCAAGATGCCAAGGATCACATTAGCTCTT
CACTCAGATTGATTTAATTAGATAAATTATTCCCTACTTTCTCAAATTTTATTCTAGATT
CTGCTGGTTAATAAATTGGTAACATAATTATAGAATATATTTGCACTCTGATTCATACTA
TAGTTTTCGCTTACATCCTCTACTTCACTGCAGCTACATCCTCCTACTTTTATTTCTTTG
TGTAAATTTTTTTAAAAAGTAATTAAGCAAATAAGAGTTAAAAACTTCATAAATAGGTAC
AAGAAAAAGAAATATTTGCCTGAATTTAAAGGAGATTTAAAAATTGCATTTGATATCAAA
TGGTCTTGTATTAACATTTTTGTTGAATCATTTTTAGTATCTGCATTAAGATTAGCTATG
CCCAGATTCTCTATGATCTACTATGATATCAATGATCATAGTTGGCTCTACATCCCTTTT
AGCATTTTATTTCATATGATGTTTGATGAAACCCTAACTTACTGGGTTCATAGATGGCTC
CACACCTTCCCTTATTTATATACCAAAGTATTTTCTTTTAACTCTTAATCATTTTAACAA
ACTGATTAGCTTTTTTAAAGCATTAACAAGATAACTACTTTATAGAATTAGATTTAATTA
GATATTTTATTACCAATAGAAATTAAATAGATCTAACTATCTATCAATTGATATCTCAAT
ATTTAATTATTTTTTTGCAAATCTGATGAATTCAAATTTTAATAATATAATTAAATGTTT
TTTTAATTAATTACAAATATCTTTTGTATTAATTTCATAATTTATAATTAGTTGCATGTA
GTTCATCATAGATCAAAAGATGTTACACCCTTCTCTGGCTTTGCTTTCCACCCACTTGAT
GCTTTTGCCTAAGCTGTCCCCACTTTTGTAAGCTGTTATTTCTTCCCTCTCCATATTAAC
ATCTTGCTTGGATTCTCATTAATTACCACAATCTGGGCCATTTCTATTCACGATAATGTT
CCTCTAGTGCCTTGCAAGCTCTTTTTGTACAGTACCCACCATTCTATCCACCACGAAGCT
GGAAGAGGTTAAATGACTAACTATGGTAAATTTACTTCTGTATGGGACAGAATATGTTAA
ACTTACTGGGATCCTGACAGGGTTTATTTTGGATGGGATGAATGGAAATAAAGAAAAGGA
ATATTCAGTAAATTCAATAGCTTTTATAGCAAAATAGTACCTGATAAAAGCTCAGAAGAA
CTAAACAAATAAATTAAACAAAAAAAGAATTGA