Identifiers and Description

Gene Model Identifier

TTHERM_01194720

Standard Name

DES5 (C-5(6) sterol DESaturase 5 )

Aliases

PreTt07509 | 270.m00035

Description

Catalyzes the introduction of a C-5(6) double bond into lathosterol and cholestanol

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.4%

TetraMine Data

TTHERM_01194720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21011.19.997093137033517e-262sterol desaturase (335 aa)
Stentor CoeruleusSteCoe_106472.2856936767186716e-49
SGDYLR056W5.9971655715910366e-21ERG3 C-5 sterol desaturase, ca
talyzes the introduction of a
C-5(6) double bond into episte
rol, a precursor in ergosterol
biosynthesis; mutants are via
ble, but cannot grow on non-fe
rmentable carbon sources
OxytrichaContig18492.0.g710.000000030002053728821195Fatty acid hydroxylase superfa
mily
DictyBaseDDB_G02796110.00010003404299092957DDB_G0279611 on chromosome: 3
position 2316340 to 2317367

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19525418: Nusblat AD, Najle SR, Tomazic ML, Uttaro AD, Nudel CB (2009) C-5(6) sterol desaturase from tetrahymena thermophila: Gene identification and knockout, sequence analysis, and comparison to other C-5(6) sterol desaturases. Eukaryotic cell 8(8):1287-97

Sequences

>TTHERM_01194720(coding)
ATGTTACAATTATAATTTTAAAATTCTTATTTAATTTATTGTTTGTTTTTGGGAAAGTAT
AATAAATAATTTACTATATTAATCGTGCTAAATGGATTAAAGATACATACATAAATAAAT
ATCAATCTTTAATAAAAATAAATAACAATAGCTTAAAGGCTAAATCAAGTTGAATAAATT
CAAGAAAAAAAATAAATTAAGTCCTCAATGGTTTATTGGCTTATTGCTGAATAGTTAGGT
TATTTTAATGTAGATAGAGTTAAGGTGATGCAAGATGCCAAGGATCACATTAGCTCTTCA
CTCAGATTGATTTAATTAGATAAATTATTCCCTACTTTCTCAAATTTTATTCTAGATTCT
GCTGGTTAATAAATTGGTAACATAATTATAGAATATATTTGCACTCTGATTCATACTATA
GTTTTCGCTTACATCCTCTACTTCACTGCAGCTACATCCTCCTACTTTTATTTCTTTGTG
TACAAGAAAAAGAAATATTTGCCTGAATTTAAAGGAGATTTAAAAATTGCATTTGATATC
AAATGGTCTTGTATTAACATTTTTGTTGAATCATTTTTAGTATCTGCATTAAGATTAGCT
ATGCCCAGATTCTCTATGATCTACTATGATATCAATGATCATAGTTGGCTCTACATCCCT
TTTAGCATTTTATTTCATATGATGTTTGATGAAACCCTAACTTACTGGGTTCATAGATGG
CTCCACACCTTCCCTTATTTATATACCAAATTGCATGTAGTTCATCATAGATCAAAAGAT
GTTACACCCTTCTCTGGCTTTGCTTTCCACCCACTTGATGCTTTTGCCTAAGCTGTCCCC
ACTTTTGTAAGCTGTTATTTCTTCCCTCTCCATATTAACATCTTGCTTGGATTCTCATTA
ATTACCACAATCTGGGCCATTTCTATTCACGATAATGTTCCTCTAGTGCCTTGCAAGCTC
TTTTTGTACAGTACCCACCATTCTATCCACCACGAAGCTGGAAGAGGTTAAATGACTAAC
TATGGTAAATTTACTTCTGTATGGGACAGAATATGTTAAACTTACTGGGATCCTGACAGG
GTTTATTTTGGATGGGATGAATGGAAATAAAGAAAAGGAATATTCAGTAAATTCAATAGC
TTTTATAGCAAAATAGTACCTGATAAAAGCTCAGAAGAACTAAACAAATAAATTAAACAA
AAAAAGAATTGA


>TTHERM_01194720(protein)
MLQLQFQNSYLIYCLFLGKYNKQFTILIVLNGLKIHTQININLQQKQITIAQRLNQVEQI
QEKKQIKSSMVYWLIAEQLGYFNVDRVKVMQDAKDHISSSLRLIQLDKLFPTFSNFILDS
AGQQIGNIIIEYICTLIHTIVFAYILYFTAATSSYFYFFVYKKKKYLPEFKGDLKIAFDI
KWSCINIFVESFLVSALRLAMPRFSMIYYDINDHSWLYIPFSILFHMMFDETLTYWVHRW
LHTFPYLYTKLHVVHHRSKDVTPFSGFAFHPLDAFAQAVPTFVSCYFFPLHINILLGFSL
ITTIWAISIHDNVPLVPCKLFLYSTHHSIHHEAGRGQMTNYGKFTSVWDRICQTYWDPDR
VYFGWDEWKQRKGIFSKFNSFYSKIVPDKSSEELNKQIKQKKN


>TTHERM_01194720(gene)
ATGTTACAATTATAATTTTAAAATTCTTATTTAATTTATTGTTTGTTTTTGGGAAAGTAT
AATAAATAATTTACTATATTAATCGTGCTAAATGGATTAAAGATACATACATAAATAAAT
ATCAATCTTTAATAAAAATAAATAACAATAGCTTAAAGGCTAAATCAAGTTGAATAAATT
CAAGAAAAGTAAAACAAGATTTATATATAATATTATTATTTAAAATAGAACTATCATAAA
ATATTATTAGAAAATAAATTAAGTCCTCAATGGTTTATTGGCTTATTGCTGAATAGTTAG
GTTATTTTAATGTAGATAGAGTTAAGGTGATGCAAGATGCCAAGGATCACATTAGCTCTT
CACTCAGATTGATTTAATTAGATAAATTATTCCCTACTTTCTCAAATTTTATTCTAGATT
CTGCTGGTTAATAAATTGGTAACATAATTATAGAATATATTTGCACTCTGATTCATACTA
TAGTTTTCGCTTACATCCTCTACTTCACTGCAGCTACATCCTCCTACTTTTATTTCTTTG
TGTAAATTTTTTTAAAAAGTAATTAAGCAAATAAGAGTTAAAAACTTCATAAATAGGTAC
AAGAAAAAGAAATATTTGCCTGAATTTAAAGGAGATTTAAAAATTGCATTTGATATCAAA
TGGTCTTGTATTAACATTTTTGTTGAATCATTTTTAGTATCTGCATTAAGATTAGCTATG
CCCAGATTCTCTATGATCTACTATGATATCAATGATCATAGTTGGCTCTACATCCCTTTT
AGCATTTTATTTCATATGATGTTTGATGAAACCCTAACTTACTGGGTTCATAGATGGCTC
CACACCTTCCCTTATTTATATACCAAAGTATTTTCTTTTAACTCTTAATCATTTTAACAA
ACTGATTAGCTTTTTTAAAGCATTAACAAGATAACTACTTTATAGAATTAGATTTAATTA
GATATTTTATTACCAATAGAAATTAAATAGATCTAACTATCTATCAATTGATATCTCAAT
ATTTAATTATTTTTTTGCAAATCTGATGAATTCAAATTTTAATAATATAATTAAATGTTT
TTTTAATTAATTACAAATATCTTTTGTATTAATTTCATAATTTATAATTAGTTGCATGTA
GTTCATCATAGATCAAAAGATGTTACACCCTTCTCTGGCTTTGCTTTCCACCCACTTGAT
GCTTTTGCCTAAGCTGTCCCCACTTTTGTAAGCTGTTATTTCTTCCCTCTCCATATTAAC
ATCTTGCTTGGATTCTCATTAATTACCACAATCTGGGCCATTTCTATTCACGATAATGTT
CCTCTAGTGCCTTGCAAGCTCTTTTTGTACAGTACCCACCATTCTATCCACCACGAAGCT
GGAAGAGGTTAAATGACTAACTATGGTAAATTTACTTCTGTATGGGACAGAATATGTTAA
ACTTACTGGGATCCTGACAGGGTTTATTTTGGATGGGATGAATGGAAATAAAGAAAAGGA
ATATTCAGTAAATTCAATAGCTTTTATAGCAAAATAGTACCTGATAAAAGCTCAGAAGAA
CTAAACAAATAAATTAAACAAAAAAAGAATTGA