Identifiers and Description

Gene Model Identifier

TTHERM_00438800

Standard Name

DES24 (C-24 Sterol DeEthylase)

Aliases

PreTt05437 | 49.m00209 | 3708.m00058

Description

Sterol deethylase; catalyzes the removal of a C-24 ethyl group from C29 sterols

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01598 ) Sterol desaturase
  • ( PF01506 ) hepatitis C virus non-structural 5a

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.8%

TetraMine Data

TTHERM_00438800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12442.19.997093137033517e-262hypothetical protein (287 aa)
OxytrichaContig18492.0.g710.00000000030007160092483236Fatty acid hydroxylase superfa
mily
SGDYGR060W0.00000000039982266684865623ERG25 C-4 methyl sterol oxidas
e, catalyzes the first of thre
e steps required to remove two
C-4 methyl groups from an int
ermediate in ergosterol biosyn
thesis; mutants accumulate the
sterol intermediate 4,4-dimet
hylzymosterol
DictyBaseDDB_G02697880.000000030002053728821195DDB_G0269788 on chromosome: 1
position 3558146 to 3559074
Stentor CoeruleusSteCoe_227520.00001670170079024566

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21257793: Tomazic ML, Najle SR, Nusblat AD, Uttaro AD, Nudel CB (2011) A novel sterol desaturase-like protein promoting dealkylation of phytosterols in Tetrahymena thermophila. Eukaryotic cell 10(3):423-34

Sequences

>TTHERM_00438800(coding)
ATGGGTTTTGTTATAACACCAAAAGTAGGTTTTATAATTGATCAATCTATAGTCTTTGGA
GGTTTCGCCTTAGGCTTAATATCTAAAAATCCTTTATAATGGTATGAAGTTTTCTTTAAA
CTCTATATAGGTCTCAACCTTGTGCTTATGCCATTTGCTGGATTAGTGACATTATTCTGT
AAAATATTTGGTAAGCGTATATAAGATCCTCCAAAACCCACTCAATATTTAAAAGAAATT
TTTGAAACTACTCGCTGCTATTGGGTAGTCTCTCTTTTGGCAGCATGGCCTGTCTAAAGA
TATCTTAATGGTGAATTGACAGCTTATACCATGGATTTAAAAGAGAGTTTTGTAGGAGAC
TCTATCATTTTAAACACTCTGTTTATGGTATTTTTCTTCTTATTAGTTGACTTCCACACT
TATTGGAAACATCGCCTTTTACATACTCGTACATTCTGGTATTTCCACAGAAATCACCAC
TCTTTCTTTGATCCTTCATGCTTTGCTTCTTTTGGAGTATCACCATTTGAATCTGTCCTT
ACTTTTGGTCCCTTATTATTTGATTAACTCGAAATAGCCAATCAATTTAAGCTCTGCACA
TGGCTTCATGGAAGTGTTATCCTTTTCTTTATAGTTTTAAATATTTACCTTCACTGTGGA
TACACATTTGACTTCATAGAAAATACTCTTCCAAAACTATTCATCAACACATCGGCCCAC
CATAACCTCCATCACTCAAAAACTAAAATTCACTTCAGTGAACTTTTGACTCTTTGGGAT
TACCTTATGAACACTGGAGCCACATTTTACAACAAACAAGAATTTTAATAAAAATTAGAA
AAAGAAAAATCTTGA


>TTHERM_00438800(protein)
MGFVITPKVGFIIDQSIVFGGFALGLISKNPLQWYEVFFKLYIGLNLVLMPFAGLVTLFC
KIFGKRIQDPPKPTQYLKEIFETTRCYWVVSLLAAWPVQRYLNGELTAYTMDLKESFVGD
SIILNTLFMVFFFLLVDFHTYWKHRLLHTRTFWYFHRNHHSFFDPSCFASFGVSPFESVL
TFGPLLFDQLEIANQFKLCTWLHGSVILFFIVLNIYLHCGYTFDFIENTLPKLFINTSAH
HNLHHSKTKIHFSELLTLWDYLMNTGATFYNKQEFQQKLEKEKS


>TTHERM_00438800(gene)
ATGGGTTTTGTTATAACACCAAAAGTAGGTTTTATAATTGATCAATCTATAGTCTTTGGA
GGTTTCGCCTTAGGCTTAATATCTAAAAATCCTTTATAATGGTATGAAGTTTTCTTTAAA
CTCTATATAGGTCTCAACCTTGTGCTTATGCCATTTGCTGGATTAGTGACATTATTCTGT
AAAATATTTGGTAAGCGTATATAAGATCCTCCAAAACCCACTCAATATTTAAAAGAAATT
TTTGAAACTACTCGCTGCTATTGGGTAGTCTCTCTTTTGGCAGCATGGCCTGTCTAAAGA
TATCTTAATGGTGAATTGACAGCTTATACCATGGATTTAAAAGAGAGTTTTGTAGGAGAC
TCTATCATTTTAAACACTCTGTTTATGGTATTTTTCTTCTTATTAGTTGACTTCCACACT
TATTGGAAACATCGCCTTTTACATACTCGTACATTCTGGTATTTCCACAGAAATCACCAC
TCTTTCTTTGATCCTTCATGCTTTGCTTCTTTTGGAGTATCACCATTTGAATCTGTCCTT
ACTTTTGGTCCCTTATTATTTGATTAACTCGAAATAGCCAATCAATTTAAGCTCTGCACA
TGGCTTCATGGAAGTGTTATCCTTTTCTTTATAGTTTTAAATATTTACCTTCACTGTGGA
TACACATTTGACTTCATAGAAAATACTCTTCCAAAACTATTCATCAACACATCGGCCCAC
CATAACCTCCATCACTCAAAAACTAAAATTCACTTCAGTGAACTTTTGACTCTTTGGGAT
TACCTTATGAACACTGGAGCCACATTTTACAACAAACAAGAATTTTAATAAAAATTAGAA
AAAGAAAAATCTTGA