Identifiers and Description

Gene Model Identifier

TTHERM_00285420

Standard Name

DED2 (DNA Elimination Defective 2)

Aliases

PreTt25871 | 26.m00223 | 3688.m00019

Description

Proprotein convertase subtilisin/kexin type 5

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00285420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09249.12.0008536325002377e-42hypothetical protein (155 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26205990: Hayashi A, Mochizuki K (2015) Targeted Gene Disruption by Ectopic Induction of DNA Elimination in Tetrahymena. Genetics 201(1):55-64

Sequences

>TTHERM_00285420(coding)
ATGGAAGAAAGCTATAAATTTGCTGAGGGGTAAAAAGAAAGCTGGATGAAGGCTAAAACT
ACTGATTAATTGTGTGATTTTCTAGAATTTGTTTCTCTTCATATAACAAATAAAAGTGTA
ATCAATGATGTTGTATAAATATTTTTGTTTTTAGAGTAAGTTAACTAAAAGCTCATATCC
GACTAAGAGTTCCTTGCTGGCTAATAAAATAAGAATTATATTTATAGCATAGAGAAAGAT
ACCATTCTTAACCGTAAAATAAGAGAGCTACTAGTGCTTATAGAACAGGATATTTAAAAG
TTTCTTTGTGAGGATAGAGAGATGCTCACATACATATAAAAAGAATTAGATTTTATTTAA
AATTGCTGTATAAGTTCAATAATACCATTCAAAGAGCAAATAATATATATTGTTAGCATG
GTTTATAGCGCACTTACAACTTTTGAGAATACTCTAAATTGA


>TTHERM_00285420(protein)
MEESYKFAEGQKESWMKAKTTDQLCDFLEFVSLHITNKSVINDVVQIFLFLEQVNQKLIS
DQEFLAGQQNKNYIYSIEKDTILNRKIRELLVLIEQDIQKFLCEDREMLTYIQKELDFIQ
NCCISSIIPFKEQIIYIVSMVYSALTTFENTLN


>TTHERM_00285420(gene)
ATGGAAGAAAGCTATAAATTTGCTGAGGGGTAAAAAGAAAGCTGGATGAAGGCTAAAACT
ACTGATTAATTGTGTGATTTTCTAGAATTTGTTTCTCTTCATATAACAAATAAAAGTGTA
ATCAATGATGTTGTATAAATATTTTTGTTTTTAGAGTAAGTTAACTAAAAGCTCATATCC
GACTAAGAGTTCCTTGCTGGCTAATAAAATAAGAATTATATTTATAGCATAGAGAAAGAT
ACCATTCTTAACCGTAAAATAAGAGAGCTACTAGTGCTTATAGAACAGGATATTTAAAAG
TTTCTTTGTGAGGATAGAGAGATGCTCACATACATATAAAAAGAATTAGATTTTATTTAA
AATTGCTGTATAAGTTCAATAATACCATTCAAAGAGCAAATAATATATATTGTTAGCATG
GTTTATAGCGCACTTACAACTTTTGAGAATACTCTAAATTGA