Identifiers and Description

Gene Model Identifier

TTHERM_00285420

Standard Name

DED2 (DNA Elimination Defective 2)

Aliases

PreTt25871 | 26.m00223 | 3688.m00019

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00285420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09249.12.0008536325002377e-42hypothetical protein (155 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26205990: Hayashi A, Mochizuki K (2015) Targeted Gene Disruption by Ectopic Induction of DNA Elimination in Tetrahymena. Genetics 201(1):55-64

Sequences

>TTHERM_00285420(coding)
ATGGAAGAAAGCTATAAATTTGCTGAGGGGTAAAAAGAAAGCTGGATGAAGGCTAAAACT
ACTGATTAATTGTGTGATTTTCTAGAATTTGTTTCTCTTCATATAACAAATAAAAGTGTA
ATCAATGATGTTGTATAAATATTTTTGTTTTTAGAGTAAGTTAACTAAAAGCTCATATCC
GACTAAGAGTTCCTTGCTGGCTAATAAAATAAGAATTATATTTATAGCATAGAGAAAGAT
ACCATTCTTAACCGTAAAATAAGAGAGCTACTAGTGCTTATAGAACAGGATATTTAAAAG
TTTCTTTGTGAGGATAGAGAGATGCTCACATACATATAAAAAGAATTAGATTTTATTTAA
AATTGCTGTATAAGTTCAATAATACCATTCAAAGAGCAAATAATATATATTGTTAGCATG
GTTTATAGCGCACTTACAACTTTTGAGAATACTCTAAATTGA


>TTHERM_00285420(protein)
MEESYKFAEGQKESWMKAKTTDQLCDFLEFVSLHITNKSVINDVVQIFLFLEQVNQKLIS
DQEFLAGQQNKNYIYSIEKDTILNRKIRELLVLIEQDIQKFLCEDREMLTYIQKELDFIQ
NCCISSIIPFKEQIIYIVSMVYSALTTFENTLN


>TTHERM_00285420(gene)
ATGGAAGAAAGCTATAAATTTGCTGAGGGGTAAAAAGAAAGCTGGATGAAGGCTAAAACT
ACTGATTAATTGTGTGATTTTCTAGAATTTGTTTCTCTTCATATAACAAATAAAAGTGTA
ATCAATGATGTTGTATAAATATTTTTGTTTTTAGAGTAAGTTAACTAAAAGCTCATATCC
GACTAAGAGTTCCTTGCTGGCTAATAAAATAAGAATTATATTTATAGCATAGAGAAAGAT
ACCATTCTTAACCGTAAAATAAGAGAGCTACTAGTGCTTATAGAACAGGATATTTAAAAG
TTTCTTTGTGAGGATAGAGAGATGCTCACATACATATAAAAAGAATTAGATTTTATTTAA
AATTGCTGTATAAGTTCAATAATACCATTCAAAGAGCAAATAATATATATTGTTAGCATG
GTTTATAGCGCACTTACAACTTTTGAGAATACTCTAAATTGA