Identifiers and Description

Gene Model Identifier

TTHERM_00301940

Standard Name

DED1 (DNA Elimination Defective 1)

Aliases

PreTt19390 | 28.m00349 | 3691.m00166

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00301940

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07723.10.0000000000499999055251093hypothetical protein (193 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26205990: Hayashi A, Mochizuki K (2015) Targeted Gene Disruption by Ectopic Induction of DNA Elimination in Tetrahymena. Genetics 201(1):55-64

Sequences

>TTHERM_00301940(coding)
ATGGGAGAGTATTAGCTTTTTGAAATACGGAACAAAGCTGTCTATGTAAACTCCCATTCT
GATGATGAAGACGATTATGAAAATGATGAAGAAGTCCAATAACTCTAAAATGTAAATTTT
ACATAGTAGAAAAGCAAGAGTTAATCAATAGAGCTACTAATTCTAGACAATCCAAAAAAC
ACAAATAAAGAGAAAATGATTTTAGAACTAAATAAGTCTTCTAAAAGCTATTATGAATTA
AAAAATGAATTAGAGCCTGCTGTTTAAGTCTAAAATGGTGCTAGAAAGTCTGCTCCTCTT
TAAAATACATCTCAAAATATTGACAATTTAGAAACCATTAATAAGAGATTATTTACTGAC
AAGAACTAATACTATCAAAAGCCATGTGCTAAAAAATCAAATATGCAATGA


>TTHERM_00301940(protein)
MGEYQLFEIRNKAVYVNSHSDDEDDYENDEEVQQLQNVNFTQQKSKSQSIELLILDNPKN
TNKEKMILELNKSSKSYYELKNELEPAVQVQNGARKSAPLQNTSQNIDNLETINKRLFTD
KNQYYQKPCAKKSNMQ


>TTHERM_00301940(gene)
ATGGGAGAGTATTAGCTTTTTGAAATACGGAACAAAGCTGTCTATGTAAACTCCCATTCT
GATGATGAAGACGATTATGAAAATGATGAAGAAGTCCAATAACTCTAAAATGTAAATTTT
ACATAGTAGAAAAGCAAGAGTTAATCAATAGAGCTACTAATTCTAGACAATCCAAAAAAC
ACAAATAAAGGTAACTAATATTTGCTAGAATTAATTTTATTAAATGATATTTAAAAATAG
AGAAAATGATTTTAGAACTAAATAAGTCTTCTAAAAGCTATTATGAATTAAAAAATGAAT
TAGAGCCTGCTGTTTAAGTCTAAAATGGTGCTAGAAAGTCTGCTCCTCTTTAAAATACAT
CTCAAAATAGTAAATTTTATTTAAAATAACTTTAATACATATTTATTATTTTTATTAAGT
TGACAATTTAGAAACCATTAATAAGAGATTATTTACTGACAAGAACTAATACTATCAAAA
GCCATGTGCTAAAAAATCAAATATGCAATGA