Identifiers and Description

Gene Model Identifier

TTHERM_00335720

Standard Name

DDI1 (DNA damage inducible 1)

Aliases

PreTt06017 | 34.m00254 | 3689.m00051

Description

UBA/TS-N domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00627 ) UBA/TS-N domain
  • ( PF00240 ) Ubiquitin family
  • ( PF00077 ) Retroviral aspartyl protease
  • ( PF08284 ) Retroviral aspartyl protease
  • ( TIGR02281 ) clan AA aspartic protease, TIGR02281

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00335720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16073.19.997093137033517e-262UBA/TS-N domain-containing pro
tein (434 aa)
OxytrichaContig11687.0.g1115.997672135862771e-69Aspartyl protease
SGDYER143W2.000065869309806e-55DDI1 DNA damage-inducible v-SN
ARE binding protein with a rol
e in suppression of protein se
cretion; may play a role in S-
phase checkpoint control; has
ubiquitin-associated (UBA), ub
iquitin-like (UBL), and retrov
iral-like proteinase (RVP) dom
ains
DictyBaseDDB_G02881871.999385218781115e-51ddi1 on chromosome: 5 position
1180046 to 1181767
WormBaseWBGene000153082.0006622580855403e-35status:Confirmed UniProt:Q17
569 protein_id:CCD62447.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000162

Sequences

>TTHERM_00335720(coding)
ATGAAAATAACAATTATAACTGAGGACGATTAATTTAAGGAAATCGAATTTGAAGCCGAC
TCAAGAGTTATAGATATTAAAGAAGTGTTATAAATTGAGTTTGGAATTCCAGTTGCAATT
CAGGAATTGTTTGCTAATAATTAGCTTATGAATAATAATAATTTGATTAGAGAATATTGT
GGCGACAACGATATGATTAGATTAAGCACCAAACAAAACTAATTTGGTAGATAATAATAG
ATGATGGGATTTAACAACAATTAAATAAACAATCAATAGTTCACAAATAATGCAACAAAT
ATTGCAAATGCTCTATCAAATTTATTTGGCAGCACACTTAATCAATCTATTCACTAAAAA
TATTTATAATAAGCTAGAGATTTTAAGAATTAAATTAAGCAATAGCCTTTTATTTTACAG
AATTTAAAAAATTAAAATCCTAAACTAGCACAGCTTCTTCAAAGCGGAACTGATGATGAA
TTGGCTTAATTTTTGTAAAAAACTGAGCAAGAAAGAATTCAAAAGAGAATGAAAGAATAG
TAGGAACTTGATGAGCTTGAAAAAGATCCTTTCAACCCTGATAATTAAAAGAAGATAGAA
GAAATTATCAACTAAAGAGTTATTGATGAAAATTTAGAAATGGCTTAGGAATATATTCCT
GAAGTTTTTGGAAAAATTACAATGCTTTATATTGATTGTGTAATTAATGATCATCCAATC
TAGGCCTTCGTTGATACAGGTGCTGAAAGTACTATTATGTCAAAAGCATGTGCAGAGAGA
TGTGGACTTATGAGATTAGTTGATAAAAGATTTTCTGGTATGGCAAGTGGTGTTGGAACT
GGAAAAATTCTTGGCCGTATTCATAAATACGCAATTTAGATATTAGATAAAAGATTTGAA
TGTTCTTTCACTATCCTTGAATCGATTAATTTAGATTTCCTTTTAGGTTTAGATAATTTA
AGAAGATTTTAATGCAATGTTAATTTAAGAGATAACACTCTTAATTTTTGGCTAGGAGAC
TCAGAACTTAAAGTCCCTTTCTTACATGAAAAAGATATTAAAAAAGTAGTTTCTATTGAA
TAAGAATAAGCCTTATTTGATGAAGAATAAAAAAGAAATCAAGAGTAGCCTCCTTTAAGT
ATGTAAAGATAGTCTAGTAGCTCATCGTAAATTATTGGTGGTACTGTAGGATTTAGAGAG
GATGACATAGGAAAATTAATCAACTTAGGAGCAACAAGAGAACAAGCAATAAATGCTTTA
AAGGCTGCAGGAGGTAACGTTGAGCTAGCAGCTAGTATTCTGACAATGAAATTTTGA


>TTHERM_00335720(protein)
MKITIITEDDQFKEIEFEADSRVIDIKEVLQIEFGIPVAIQELFANNQLMNNNNLIREYC
GDNDMIRLSTKQNQFGRQQQMMGFNNNQINNQQFTNNATNIANALSNLFGSTLNQSIHQK
YLQQARDFKNQIKQQPFILQNLKNQNPKLAQLLQSGTDDELAQFLQKTEQERIQKRMKEQ
QELDELEKDPFNPDNQKKIEEIINQRVIDENLEMAQEYIPEVFGKITMLYIDCVINDHPI
QAFVDTGAESTIMSKACAERCGLMRLVDKRFSGMASGVGTGKILGRIHKYAIQILDKRFE
CSFTILESINLDFLLGLDNLRRFQCNVNLRDNTLNFWLGDSELKVPFLHEKDIKKVVSIE
QEQALFDEEQKRNQEQPPLSMQRQSSSSSQIIGGTVGFREDDIGKLINLGATREQAINAL
KAAGGNVELAASILTMKF


>TTHERM_00335720(gene)
ATGAAAATAACAATTATAACTGAGGACGATTAATTTAAGGAAATCGAATTTGAAGCCGAC
TCAAGAGTTATAGATATTAAAGAAGTGTTATAAATTGAGGTATTAAATTAGAATTGATAG
TATTTTAATTTAATATTCTAATTTTTTGATGGTGTAATAATAAAAAAGTTTGGAATTCCA
GTTGCAATTCAGGAATTGTTTGCTAATAATTAGCTTATGAATAATAATAATTTGATTAGA
GAATATTGTGGCGACAACGATATGATTAGATTAAGCACCAAACAAAAGTACTCAGTTATT
CATAAAGTCAATATTAACATTTTTTTAACTTTAAAATAGCTAATTTGGTAGATAATAATA
GATGATGGGATTTAACAACAATTAAATAAACAATCAATAGTTCACAAATAATGCAACAAA
TATTGCAAATGCTCTATCAAATTTATTTGGCAGCACACTTAATCAATCTATTCACTAAAA
ATATTTATAATAAGCTAGAGATTTTAAGAATTAAATTAAGCAATAGCCTTTTATTTTACA
GAATTTAAAAAATTAAAATCCTAAACTAGCACAGCTTCTTCAAAGCGGAACTGATGATGA
ATTGGCTTAATTTTTGTAAAAAACTGTAAAATATTTTATAATAAAATACATAAAATTGAA
TATTTAAATATTTATATCAAGGAGCAAGAAAGAATTCAAAAGAGAATGAAAGAATAGTAG
GAACTTGTAAGATTCTATAATTAATCAAAACCTTCATATTTAAATATAAATTATATATCA
ATAAATAGGATGAGCTTGAAAAAGATCCTTTCAACCCTGATAATTAAAAGAAGATAGAAG
AAATTATCAACTAAAGAGTTATTGATGAAAATTTGTATTATTTATTTTATTTGTTTAGAT
TTTAATTTGATATAATTATTTAAATAGAGAAATGGCTTAGGAATATATTCCTGAAGTTTT
TGGAAAAATTACAATGCTTTATATTGATTGTGTAATTAATGATCATCCAATCTAGGCCTT
CGTTGATACAGGTGCTGAAAGTACTATTATGTCAAAAGCATGTGCAGAGAGATGTGGGTA
TTCAATAATTTTTATTTAACCAAAGGTTATAATAATAAATAATAAAAAGACTTATGAGAT
TAGTTGATAAAAGATTTTCTGGTATGGCAAGTGGTGTTGGAACTGGAAAAATTCTTGGCC
GTATTCATAAATACGCAATTTAGATATTAGATAAAGTAATAAAAAATATAATCCAAAGAA
GTCATATAAAATTTTTAATCAAAATAAATAGAGATTTGAATGTTCTTTCACTATCCTTGA
ATCGATTAATTTAGATTTCCTTTTAGGTTTAGATAATTTAAGAAGATTTTAAGTATTTTT
TTAAATGTATATTTCATTAACTCATTTTAATTATTTTGTGAATAGTGCAATGTTAATTTA
AGAGATAACACTCTTAATTTTTGGCTAGGAGACTCAGAACTTAAAGTCCCTTTCTTACAT
GAAAAAGATATTAAAAAAGTAGTTTCTATTGAATAAGAATAAGCCTTATTTGATGAAGAA
TAAAAAAGAAATCAAGAGTAGCCTCCTTTAAGTATGTAAAGATAGTCTAGTAGCTCATCG
TAAATTATTGGTGGTACTGTAGGATTTAGAGAGGATGACATAGGAAAATTAATCAACTTA
GGAGCAACAAGAGAACAAGCAATAAATGCTTTAAAGGCTGCAGGAGGTAACGTTGAGCTA
GCAGCTAGTATTCTGACAATGAAATTTTGA