Identifiers and Description

Gene Model Identifier

TTHERM_00316190

Standard Name

DCR2 (DiCeR )

Aliases

PreTt20930 | 31.m00232 | 3687.m00034

Description

Dicer-related RNase III protein; one of three Dicer-like proteins described in T.thermophila

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF07620 ) SLEI
  • ( PF04548 ) AIG1 family
  • ( PF00350 ) Dynamin family
  • ( PF08477 ) Miro-like protein
  • ( TIGR01612 ) rhoptry protein
  • ( PF07661 ) MORN repeat variant
  • ( TIGR01257 ) rim ABC transporter
  • ( TIGR00158 ) ribosomal protein L9
  • ( PF07693 ) KAP family P-loop domain
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR02473 ) flagellar export protein FliJ
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF02881 ) SRP54-type protein, helical bundle domain
  • ( PF02263 ) Guanylate-binding protein, N-terminal domain
  • ( PF08432 ) Fungal protein of unknown function
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein
  • ( PF04297 ) Putative helix-turn-helix protein, YlxM /

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00316190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08475.19.997093137033517e-262type III restriction enzyme, r
es subunit protein (2766 aa)
DictyBaseDDB_G02918105.0019039340728934e-39DDB_G0291810 on chromosome: 6
position 784328 to 786502

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22706992: Talsky KB, Collins K (2012) Strand-asymmetric endogenous Tetrahymena small RNA production requires a previously uncharacterized uridylyltransferase protein partner. RNA (New York, N.Y.) 18(8):1553-62
  2. Ref:20622019: Talsky KB, Collins K (2010) Initiation by a eukaryotic RNA-dependent RNA polymerase requires looping of the template end and is influenced by the template-tailing activity of an associated uridyltransferase. The Journal of biological chemistry 285(36):27614-23
  3. Ref:19451546: Lee SR, Talsky KB, Collins K (2009) A single RNA-dependent RNA polymerase assembles with mutually exclusive nucleotidyl transferase subunits to direct different pathways of small RNA biogenesis. RNA (New York, N.Y.) 15(7):1363-74
  4. Ref:17603500: Lee SR, Collins K (2007) Physical and functional coupling of RNA-dependent RNA polymerase and Dicer in the biogenesis of endogenous siRNAs. Nature structural & molecular biology 14(7):604-10
  5. Ref:16199890: Malone CD, Anderson AM, Motl JA, Rexer CH, Chalker DL (2005) Germ line transcripts are processed by a Dicer-like protein that is essential for developmentally programmed genome rearrangements of Tetrahymena thermophila. Molecular and cellular biology 25(20):9151-64
  6. Ref:15598983: Mochizuki K, Gorovsky MA (2005) A Dicer-like protein in Tetrahymena has distinct functions in genome rearrangement, chromosome segregation, and meiotic prophase. Genes & development 19(1):77-89

Sequences

>TTHERM_00316190(coding)
ATGGGTTGTGTTTGTGCAAAACCAAAACCACAAAGCAATAAAAGCATAAAAAAAGAGGAG
AATCAGGGCATAAAAGCAAATAGGTCCGATTCACCAAGTTAAGAAAAGAATAATGCAAAG
GAAGAGTTGCATACAAATAAAGAAGAAACTTAGATGGATCTTTTATAAAAGAAAGAAATT
TATATAGATGAGTACGAGGAAGAAGAAGTAAATAGGTACGAAGAATTTGAATAAAAAGAT
AGAGCACTTTTAGCTAAATACTCATAAGTTATGGATAGAGGCAAAAAGGTTAAACTTGAG
ATTGAAAATCAAAAAGAAAAGCCAAAACTCAATTAAGGCTCAGAGAAGAGATTCAAAGAG
CTTTTGAATTTAACTTAGATGATTGAATCTAATTTAGAATAATCAGAGCTCATTCAAGGT
AAAGATATTGTGATAGTCCTAGGTGCTACAGGAGTAGGAAAATCTACTACTATTAACTAC
TTGCTCGGAAAGAAGATGATTTGGTCTAAGATTTAAAACTAAACAAAAAGCTATGTTTAT
GAAGTAGAAGGAATTACTGTGGCTAAAGGAGAGCAAGAGGCTGCTAAAATAGGAACTAAA
CCAATGGAATCTTAAACTAAAACTATTAACGTTTACAATGTTTAGCATCCAAAAGATGAA
AGAGAGCTTGTACTTTGTGATACTCCAGGTCTTTTAGACTCTTAGGGATCCATAGTAGAT
ATAGCAAACCAAGTTGGAATAGTAAAATCTTTATAGTATGCCAAATCTATTAGAGTTTTG
TTGCTTATCGGATACAAGAATCTTGTTTCTGTTGAAGGCAAGGGTAAGCTCATAAAAGAA
GTTATTGATTTATATAGCAAGCTAATTAAGGACTATGAAGAGTCTTAAGAAAGCGTGTTG
ATTGGTTTCACCCATTTAAATAGCGATACTACTCTTTAGCAGATCAATAATTCTTTAAAA
GCAATGACTGATTCTGTAAGCGATGATGATAAGGTTTCCCAATTTCTTCATATATCAATA
CAAAGCATAGAAAAGAAAAACAAACTCTTTACACTTATAAAGCCACTAATAAGCGATAAG
AGATAGAATTTAATCGACTCTCTTTTTAACATATAAGAAATTCCTTAGGAAAGAGTTAAT
TAGTATTTTACATATGCTCTTGCATAAAATACAAAAAACGAATTTGAACTTATCCTTCAA
AGTTATTAAAAAGATATTTCAAATTTATTTTAGAGGGAAGAATATGATCAAATTACTAAC
AGATTAAGTGTTCTCAAAAAACTAAACGAGCAATTGGAATTTACAATTGTCAAGAAATGT
TATGCTGAAAGCGTGCAAGCAGTGATCAATCTAGACTTAGTCAAGTAGACTTAATCACTT
TTGCAGAGAATAACTTCCTTATAGCAAGAAATGGTGCAAATCCTTTTATAAAATATTGTT
AAAGTTTCTAATTATCTGTGCTGGACAGATTAAATTAGACACGAATACTAAGAAATAAAT
GATTGCATAATTTCTTATAATGATTTTATAGACATTCTTTCTAGCGCGCTAGAGGAATGC
CTTTAATCTATTGAAAAAACAGAAAATTACAAAGTTACAATTTAAGATTTGTTAAAGCTT
TATTATGTTTACTACTGTAGTGAAATAGAAGATACATTCAAGGCCAATGCTAAGACACTC
CGTATTTTCCATAAAGGTTAGGTTAAAATAAAGAGTATTTACACAAATAACTTTTATACT
GCTGCTTGCTTTTCTATAAGCAAAAGAGTTATAACTCTCTTGGAATAGATGGATGAGTTA
GTTAAATCTAATGAAGAAGTCAATGTTAACGATTTAGAATCAAACTTATCTAAGCTTAAA
GATTTGCATGAATAATAAGTAGGAGATCACCTCTAGTTAAATTCTTAGCTGATTTATCAA
GAGCAAGTAAAAAAATGGTGTGATTTCATTTAGCAAAAGAAGACAGTTTTTGAAATAGAT
TATAACAAATACGATTAAGTGTTAAAAAATATAGATCAAATGAAGATAGCTTATCACTTT
TTAGCTTAAATTAGCGGATCATAGAGACTAATGAATGATCATTTCCCATAATTTAAAACA
GCTTAAAAAGACACTACACAAAAATTAGTATAGCAAGCAATCATGCTTTTTAATAAAGCA
ATTACTCAAAAAAAACTAGGACATATGGAAAAACCAATTTAATGTGCCATGGAAATAATG
AATATTAGCGACGATATAAGAAATAAATTGCAAGAAGCCTCTCAAGCACTCTTTGTTCAT
TTAGGATCAATTGTTTAAAAGTTCGACATGAAATTCAGCAGCTGCTCTTCATAGATAAAA
AATTGTTTGATCCCAAAATACGAAACAGCTAATAAGGACTTATTTAAAAGCACAACAGAA
GATGAATTCTAAATTGTGAAGAAAAAAATTAATTCAATCCAAAAAATCTTTAAAAAGATC
ACTATGAAGTATTACTAATCATTCAAATTCTTTTAGAACTCAGTGACAAAGAGCAAAATC
GCATTGGAGATTTTTATTGAAGAAGTTATGAAGTTCACACAAGACCAAGTTAATGAATTC
AGAAATCCTACAGGAATTTTAAATGGCTTATTCACTTTAAAGCAGTCTTCTATACTCTTA
AAAGACTACACTAATAAAAAATTTGACGAAATAGCATTTTAGGAAATGATTTCTCTTATT
TGCAACAATATAAACACAAAATTTTCTTTAATAACTAAAATGGTAAACAGCATTCAAATC
CCTAATAACATTGATGATACTTACAGAAATATTGAGGAACAAATCAAGAATATCAGCCAT
TTACTCTAATTCATTTAAAACCTTTCAAATTATATTTTAAATTTTGAAGATAAAAATCAA
AACACAATTGAGTCTCTTATTCAAATGGTTACTAATTGCTAGAATGGATTTGCTTAATAA
TTATTCAACAAGCTTAAATCTAATATGTATGATTTCGAACATTAAAAGCTACCATCTGAT
GCTATGAGATAAAAGATCATTCTCGATTAACTATAAAAACTTAAAGAATACAATTACAGC
TATTCTCTACTTAAAGTTGATCTATACGAACATGTCTTAGAAAAATCTATTTCTGAGTAA
TCTAGACTTATTAAGGAAATCAGTGACTATTTGTCAGACAATCCATCTTTACCTGATGAT
TTTAATTAAGAAAGTGCTTAGAAAAATCTTACTTTGATTAGATAAGCCGGAGTACTTTAT
CTAACCCATTTCATTGGAAGACTAGATAATCCTGCTGATACTCTTCAAAGTGAATTGACT
ATGAAATAAAAAGGATTGGATAAAAAAGTCAAAAGCATGGTTAAGCAATCTGATTATGAC
CAAATATTAGAGTACATGAGAACCATGAGTGAGGATAACGAATCTTATAAATCAATAAAG
AAGATTTTAAAGGAGAAGGTTAATATGCTCTTCGATTAAATAATTAAATCCTTCACCAAA
AGAAATATTTTGGATGACATTTATATTAATAAAATTAAACAAGACATAAGAAATTTAGAA
TAATCTAAATAGAAGCTGTCACAAATTAAATTCAAAAATTTTAGCATTGAAAAATTCTTC
CCTCAAATAACTCATCACTTGACTGCCTTTTTATAGAAATAAGTAAAGAGATTTGAAGAA
AAAATAGCTACTTAAAAAGTAGAGAAGGCCAGCCGTTGCTTGATGGTTGTTTGTAGAGTT
GTGTAGAATTTTTAGAGCTATATTAGACCCGAGGATAACTAACTACCTGATAAAATGATC
AACCAAATGAAGCTCTGTCTGCGCTAAATAGAAAACTAAATTGACATTAAAAACAAACAA
CAAACAACTTCCATTCTCCAAGTTCTTTAGGTACTAGTACAGAACTAACACCAATACAAG
GATGAATATAATTTAATCTTATAAAAAGTGAATAAATAAATTTTGGAACAAGCAGCAGTG
TTCGTAAACACAAAGATAGATTCATAAAACGAAGAAATAAGCGTCCAAGCTATAGCTGAA
ACTCTTAAGGGTGAATATTAGTATTTACTTATGTACACTTTAGATAACTATAACTAGCAT
TATCTAGCTTTCTTCTAGCCCATATTGAAGAGAATTTAAGATGAAATGTTAGATGTGAGA
AATATGTTTACTCAACGTAAGATTACAAACATCCTCAATTTAATTAATGGATCTAAAAGT
TCAATAGTTTAAAAAGAGGTCTGTAATTAATACAATAATCTCTGTGATACTTTCTTTGAT
TTACTCCAAAATAGAAATTATAATGGCACTTAAGAACTTCTCAAATTCCTCTCATAAATT
GCTGACGGTATTCGTTCTTTCTCCTACAACTCCTTGAAACAGAAATATTTTGAATTGTAA
GTTTGCATAGAGTAAGAATTTAATAGGTTACAAACTTCAACTGTACAAAGTCTAAACTAA
ATTGTTTTTGAGAGAGAATCTGAAGGAATTTATGATGTTGTTTAATTTTATTAATTCAAC
TCCTTAATGGCTTAATTTAACTTTTAATATGTCAAACATGAATAATTCAATACATAATCT
TGCCAAGTCTTCGATAAAATATAAAAATAATTAAAACAGTCTGTATCTCTTTTGCAGCAC
ACTGTCTTTAACAATACAGTAAAACTAATTGATTTCATTGAATAGACAAGGGTAAGTTTG
AATGATTAACAAATTAATGTAATCTAAATCTACAAGAAATATTTATCTGATATGCAATCA
ACTCATTCACATGTTAGCAGCTTCAACGATCTCAATAAATTAGTGAATGATGGATGCTGG
ACTATCTAATAAGTTATATCTGATTTACTTAATGCAAAGAAAAATGAAATTGTTAATGGA
ATCAATTCGTTACTTATACAAAAAAATTACAAGGAAACTTCAAGAATTTTAAGGTAAGTA
GAGGAGTTCTCAAAGAAAATTTAAGAGAGCTCTGTTAATATGAACACTTCAGACATCATG
AAGGTAGTATTTAGAAAATACGAAGAGAAAGCAATAGAAGCTCAAAGAAGATCAAAGGAT
AAGTATGATTCTAAGCTATTTGCATTGATAGAAGATTTATCTGAAATAGAAAAATATTTT
AAGGAAATCATAGTTCAAATCTCCAACTATAATGCATCAGAAGAAATAATCAACTAAATT
AAATTATCTATAGCCCAATTAACTAAACAAATTTATTCCTAAAATTTCGAGGATGAATCA
GACGTGAGAGAGTTTGTTGCATCTATTATTAATATCAGATAAATAGCATTCGAAATAGGA
CAAGTCCATGAATTCACTCTTGAATAAATAAGTGAGCTTATCACAACTAAATTTTAATAA
TTTACACCTCAATTCATTTCAGATGTTTCATCTAAGTTGAGATAAGATAAACTTGGTTTA
TTGATAATCTAGGAAAATAGTAAAAACTTCGAAGGTCTTCTTAACAAGATGATTGAGGAA
CTTTCCAAGAATTAATTCAGCTTGGAATATGTAAACAATAATATTAAAGGTGAAAAATTC
ATTGCAAGTGAGTTTTCAATCCAATATAAATATTATGAAGAGTGCTGGAAAAACCTCCTA
AGCAAGTGGCACTAAGGAGATCTCAAAGCAGAAACTATTTTATAAAAGACAAAGTCTTTG
TTTAAAAAATTCTGCTCATCCTACTAAGTCGATTACTTGAATCAAAAGTAAATCACTTGG
TCAGCATCATAGAAGTAAGATCTTTCTATCATGCTAGCTCACTTGAGTACTTTCTGGTCT
ATAGTAAACTGCCAAAGAAGAGAAGACAGTTTCAGAAAATTGCATCCTGTTTAAGTTTCA
ACTGTAATGAGATTGCTCTCAATAGATACAACAACTACTTAGATGCCTATTGAAAACCAT
CTAGTTTAGGTAAAGACAGGTGAAGGTAAATCTATCATTTTGGGAATTACTTCTTGCTTC
TTAGGCTTACTAGGATTCTATGTAGATTGCTGCTGCTACAGTAATTATCTAAGTTAGCGT
GATTTTTAGAGCTTCAGTCATATTTTCTAGCAATTAGAAATTGATAATGTAATTAAATAT
AACACTTTTGAGAAATAATTCGAAGATATAATTAATGATCCAGAAGATATGAGATAAGTC
GGTTTAGATTTACTTGATAATAAGTTACATAAAAAGGTACAGATATAAAGATAAGGGTCT
TTGGGCAGTTAACCAAAGAGAAGAATTCTTCTTATTGATGAAGTAGATTTCTTTTTCGGT
GAAGATTTCATTGGTCGTACTTACCCTGTTGCACTCTATTACAATAATCAAGATGTTATT
GATATTTTGAAATATATCTGGTAGAATAGAGCTGTTCATATCGATAAGTTTAAGTAAACA
CAAGTATATAAAAAGCTATTTTAGAACAATCCAAATTTAGTTCCTTGGTAAGCATTTATT
GATGAACGTATAAAAATGATGTACGAAGATGTAAATAATCTTGAAGGCCACAGATATTTG
ACATATACTCCTTCTGGAAAAAGCAAAACAATTATTTGCTATAAATCTCTTGATGGCATT
TCCTTCAATACAGTCAAAGGATACAAAACAGCTTTTGCTTATATCTAAGAGTGGGAAAAG
AAGAATATAACAGAAGATGTTATGAATGAAAACCTTTCATTTATAATTAATGTAGGCTGC
TTCTCATTCGCTTAGATACCTTAGGAATATCAACTGGTATTGGGAGTCAGTGGTACTTTA
GAAGATATGAGTGATTATCAGAAAAATTTAACTAGAAATCTCTTCAACATAAGAAAATTA
ACAATCTCCCCATCAATTTATGGGTAGTCTAAATTTTCTTTTAAAAAAGAAAAGGACGTA
GTTGTAAAAGAGAATAAGTTCCTTTATCATTTAGAAATATAATCTCAAATAGAAAACGTT
ATGAAGTAAAATAGATCAGTAATAGTATTCTTTGAGTCGAAGAGGGCATTAGACATTTTT
AAAAATGAGTTTAAAACATAATACGATTATTAAGTTCTTTCTGAAGAAACTAATTTCAAA
GGACACACAATAGTTAAAGCAGGTTCTATGAGCATGATAACACTCGCAACAAAGCCTTTT
GGTAGAGGCTGTGATTATATCAGCACAGATCCTGAGCTGGATAAGAATGGTGGTATTCAT
ATTATCTAAACCTTCCTCTCTGAAGATCTAGCAGAAGAGACTCAAATAAAAGGTAGAACT
GCAAGACAAGCTTAATGTGGTAGCTACAGTTTAGTAGTCAACAGAGAAGATCTTGTACTA
AACTTTAATCTAAATGCTAGTGTTAAAAATTTCTCTTATGAATTCTTACACCAATTGAGA
TAAACCACCTAAAAAAACAAAGAAAAATCTTTATCAATAAAGCTTGAAGAAACAAGCTAA
TCTCACAAGGAATCTATGCGTCTAAAGCAAATTTTGCTAAATTATTCTCCTAATAACAAT
GAAGAAATACAAGAAATATTAATCAAATTTAACAGGGTCACAGACAGAACTGAGAATAAA
ACAAATATGTATAATTTCTATAGTGATTTAGCAGGTAAAATTGGTATCTATGAAAATAAT
TTCGAGTACGACGAGTATAACAATCCTAAAAATGTTGGTTTGGGTAGTGACAATTCATAT
AATGATCTATCACTATTGATAGGTCTATTTTATCCAGAAGAAGGACTAGATGAAGACATT
AATCATTTATTAATACCAACATTAAGAAAGAAGGGTTTCAAAGTTTGTGAAGTCGTTGTT
ACTGAGCAGGAATTTATCGTAAAGCTACCTTAATTCGATTAAGCTTGGGTTATAAGTGGA
TATAAGTTCCACTCTCATAGAATGGAAAGCAGATTCTAAGATGCTATAGAATATCACTTG
AAACAACAAAAGGGTTTGATGATTTGGGCTGATAATAATCCTTATATTGTGCATGCAAAT
CTGATACTTTAAAGAATTCCAGTTGGTTATTATAATAGATAACCTATCTTTATTAAATTA
GATGGTTCTGATTATGGTGATTAGGTCTTAAAGGCTGGTGATTACTTTGAAACTTAATAG
TTCGGTCCACATTTAATTACTACTGGTATCAATAATCTCCACGAGGGTATTACTATCTGC
TATCCTTAAGTACTGAGCAATACACCAAAAGATAACTTTGGCCATCTTAATATTATCGGA
TTAAGCAGTGCTTCCAAGCCATGTTTCTTTGTGCTCTCCGGAACAGAGGATAGAGGTAGA
ATTGTATTTGATTGTGGTTTTACAAAACTAATGAGAGATTAATGGAACACTGCTGGTACA
GTTACCTATGTAACTAATTGTTATGCTTGGCTATATTGGAAGGAAAGATTCGTATAAAAT
TTATGA


>TTHERM_00316190(protein)
MGCVCAKPKPQSNKSIKKEENQGIKANRSDSPSQEKNNAKEELHTNKEETQMDLLQKKEI
YIDEYEEEEVNRYEEFEQKDRALLAKYSQVMDRGKKVKLEIENQKEKPKLNQGSEKRFKE
LLNLTQMIESNLEQSELIQGKDIVIVLGATGVGKSTTINYLLGKKMIWSKIQNQTKSYVY
EVEGITVAKGEQEAAKIGTKPMESQTKTINVYNVQHPKDERELVLCDTPGLLDSQGSIVD
IANQVGIVKSLQYAKSIRVLLLIGYKNLVSVEGKGKLIKEVIDLYSKLIKDYEESQESVL
IGFTHLNSDTTLQQINNSLKAMTDSVSDDDKVSQFLHISIQSIEKKNKLFTLIKPLISDK
RQNLIDSLFNIQEIPQERVNQYFTYALAQNTKNEFELILQSYQKDISNLFQREEYDQITN
RLSVLKKLNEQLEFTIVKKCYAESVQAVINLDLVKQTQSLLQRITSLQQEMVQILLQNIV
KVSNYLCWTDQIRHEYQEINDCIISYNDFIDILSSALEECLQSIEKTENYKVTIQDLLKL
YYVYYCSEIEDTFKANAKTLRIFHKGQVKIKSIYTNNFYTAACFSISKRVITLLEQMDEL
VKSNEEVNVNDLESNLSKLKDLHEQQVGDHLQLNSQLIYQEQVKKWCDFIQQKKTVFEID
YNKYDQVLKNIDQMKIAYHFLAQISGSQRLMNDHFPQFKTAQKDTTQKLVQQAIMLFNKA
ITQKKLGHMEKPIQCAMEIMNISDDIRNKLQEASQALFVHLGSIVQKFDMKFSSCSSQIK
NCLIPKYETANKDLFKSTTEDEFQIVKKKINSIQKIFKKITMKYYQSFKFFQNSVTKSKI
ALEIFIEEVMKFTQDQVNEFRNPTGILNGLFTLKQSSILLKDYTNKKFDEIAFQEMISLI
CNNINTKFSLITKMVNSIQIPNNIDDTYRNIEEQIKNISHLLQFIQNLSNYILNFEDKNQ
NTIESLIQMVTNCQNGFAQQLFNKLKSNMYDFEHQKLPSDAMRQKIILDQLQKLKEYNYS
YSLLKVDLYEHVLEKSISEQSRLIKEISDYLSDNPSLPDDFNQESAQKNLTLIRQAGVLY
LTHFIGRLDNPADTLQSELTMKQKGLDKKVKSMVKQSDYDQILEYMRTMSEDNESYKSIK
KILKEKVNMLFDQIIKSFTKRNILDDIYINKIKQDIRNLEQSKQKLSQIKFKNFSIEKFF
PQITHHLTAFLQKQVKRFEEKIATQKVEKASRCLMVVCRVVQNFQSYIRPEDNQLPDKMI
NQMKLCLRQIENQIDIKNKQQTTSILQVLQVLVQNQHQYKDEYNLILQKVNKQILEQAAV
FVNTKIDSQNEEISVQAIAETLKGEYQYLLMYTLDNYNQHYLAFFQPILKRIQDEMLDVR
NMFTQRKITNILNLINGSKSSIVQKEVCNQYNNLCDTFFDLLQNRNYNGTQELLKFLSQI
ADGIRSFSYNSLKQKYFELQVCIEQEFNRLQTSTVQSLNQIVFERESEGIYDVVQFYQFN
SLMAQFNFQYVKHEQFNTQSCQVFDKIQKQLKQSVSLLQHTVFNNTVKLIDFIEQTRVSL
NDQQINVIQIYKKYLSDMQSTHSHVSSFNDLNKLVNDGCWTIQQVISDLLNAKKNEIVNG
INSLLIQKNYKETSRILRQVEEFSKKIQESSVNMNTSDIMKVVFRKYEEKAIEAQRRSKD
KYDSKLFALIEDLSEIEKYFKEIIVQISNYNASEEIINQIKLSIAQLTKQIYSQNFEDES
DVREFVASIINIRQIAFEIGQVHEFTLEQISELITTKFQQFTPQFISDVSSKLRQDKLGL
LIIQENSKNFEGLLNKMIEELSKNQFSLEYVNNNIKGEKFIASEFSIQYKYYEECWKNLL
SKWHQGDLKAETILQKTKSLFKKFCSSYQVDYLNQKQITWSASQKQDLSIMLAHLSTFWS
IVNCQRREDSFRKLHPVQVSTVMRLLSIDTTTTQMPIENHLVQVKTGEGKSIILGITSCF
LGLLGFYVDCCCYSNYLSQRDFQSFSHIFQQLEIDNVIKYNTFEKQFEDIINDPEDMRQV
GLDLLDNKLHKKVQIQRQGSLGSQPKRRILLIDEVDFFFGEDFIGRTYPVALYYNNQDVI
DILKYIWQNRAVHIDKFKQTQVYKKLFQNNPNLVPWQAFIDERIKMMYEDVNNLEGHRYL
TYTPSGKSKTIICYKSLDGISFNTVKGYKTAFAYIQEWEKKNITEDVMNENLSFIINVGC
FSFAQIPQEYQLVLGVSGTLEDMSDYQKNLTRNLFNIRKLTISPSIYGQSKFSFKKEKDV
VVKENKFLYHLEIQSQIENVMKQNRSVIVFFESKRALDIFKNEFKTQYDYQVLSEETNFK
GHTIVKAGSMSMITLATKPFGRGCDYISTDPELDKNGGIHIIQTFLSEDLAEETQIKGRT
ARQAQCGSYSLVVNREDLVLNFNLNASVKNFSYEFLHQLRQTTQKNKEKSLSIKLEETSQ
SHKESMRLKQILLNYSPNNNEEIQEILIKFNRVTDRTENKTNMYNFYSDLAGKIGIYENN
FEYDEYNNPKNVGLGSDNSYNDLSLLIGLFYPEEGLDEDINHLLIPTLRKKGFKVCEVVV
TEQEFIVKLPQFDQAWVISGYKFHSHRMESRFQDAIEYHLKQQKGLMIWADNNPYIVHAN
LILQRIPVGYYNRQPIFIKLDGSDYGDQVLKAGDYFETQQFGPHLITTGINNLHEGITIC
YPQVLSNTPKDNFGHLNIIGLSSASKPCFFVLSGTEDRGRIVFDCGFTKLMRDQWNTAGT
VTYVTNCYAWLYWKERFVQNL


>TTHERM_00316190(gene)
ATGGGTTGTGTTTGTGCAAAACCAAAACCACAAAGCAATAAAAGCATAAAAAAAGAGGAG
AATCAGGGTAATATCCATTAAACTTAATAGCTTTAATTCTAATGAATAATTTAATTGAAT
TGAGTAGGCATAAAAGCAAATAGGTCCGATTCACCAAGTTAAGAAAAGAATAATGCAAAG
GAAGAGTTGCATACAAATAAAGAAGAAACTTAGATGGATCTTTTATAAAAGAAAGAAATT
TATATAGATGAGTACGAGGAAGAAGAAGTAAATAGGTACGAAGAATTTGAATAAAAAGAT
AGAGCACTTTTAGCTAAATACTCATAAGTTATGGATAGAGGCAAAAAGGTTAAACTTGAG
ATTGAAAATCAAAAAGAAAAGCCAAAACTCAATTAAGGCTCAGAGAAGAGATTCAAAGAG
CTTTTGAATTTAACTTAGATGATTGAATCTAATTTAGAATAATCAGAGCTCATTCAAGGT
AAAGATATTGTGATAGTCCTAGGTGCTACAGGAGTAGGAAAATCTACTACTATTAACTAC
TTGCTCGGAAAGAAGATGATTTGGTCTAAGATTTAAAACTAAACAAAAAGCTATGTTTAT
GAAGTAGAAGGAATTACTGTGGCTAAAGGAGAGCAAGAGGCTGCTAAAATAGGAACTAAA
CCAATGGAATCTTAAACTAAAACTATTAACGTTTACAATGTTTAGCATCCAAAAGATGAA
AGAGAGCTTGTACTTTGTGATACTCCAGGTCTTTTAGACTCTTAGGGATCCATAGTAGAT
ATAGCAAACCAAGTTGGAATAGTAAAATCTTTATAGTATGCCAAATCTATTAGAGTTTTG
TTGCTTATCGGATACAAGAATCTTGTTTCTGTTGAAGGCAAGGGTAAGCTCATAAAAGAA
GTTATTGATTTATATAGCAAGCTAATTAAGGACTATGAAGAGTCTTAAGAAAGCGTGTTG
ATTGGTTTCACCCATTTAAATAGCGATACTACTCTTTAGCAGATCAATAATTCTTTAAAA
GCAATGACTGATTCTGTAAGCGATGATGATAAGGTTTCCCAATTTCTTCATATATCAATA
CAAAGCATAGAAAAGAAAAACAAACTCTTTACACTTATAAAGCCACTAATAAGCGATAAG
AGATAGAATTTAATCGACTCTCTTTTTAACATATAAGAAATTCCTTAGGAAAGAGTTAAT
TAGTATTTTACATATGCTCTTGCATAAAATACAAAAAACGAATTTGAACTTATCCTTCAA
AGTTATTAAAAAGATATTTCAAATTTATTTTAGAGGGAAGAATATGATCAAATTACTAAC
AGATTAAGTGTTCTCAAAAAACTAAACGAGCAATTGGAATTTACAATTGTCAAGAAATGT
TATGCTGAAAGCGTGCAAGCAGTGATCAATCTAGACTTAGTCAAGTAGACTTAATCACTT
TTGCAGAGAATAACTTCCTTATAGCAAGAAATGGTGCAAATCCTTTTATAAAATATTGTT
AAAGTTTCTAATTATCTGTGCTGGACAGATTAAATTAGACACGAATACTAAGAAATAAAT
GATTGCATAATTTCTTATAATGATTTTATAGACATTCTTTCTAGCGCGCTAGAGGAATGC
CTTTAATCTATTGAAAAAACAGAAAATTACAAAGTTACAATTTAAGATTTGTTAAAGCTT
TATTATGTTTACTACTGTAGTGAAATAGAAGATACATTCAAGGCCAATGCTAAGACACTC
CGTATTTTCCATAAAGGTTAGGTTAAAATAAAGAGTATTTACACAAATAACTTTTATACT
GCTGCTTGCTTTTCTATAAGCAAAAGAGTTATAACTCTCTTGGAATAGATGGATGAGTTA
GTTAAATCTAATGAAGAAGTCAATGTTAACGATTTAGAATCAAACTTATCTAAGCTTAAA
GATTTGCATGAATAATAAGTAGGAGATCACCTCTAGTTAAATTCTTAGCTGATTTATCAA
GAGCAAGTAAAAAAATGGTGTGATTTCATTTAGCAAAAGAAGACAGTTTTTGAAATAGAT
TATAACAAATACGATTAAGTGTTAAAAAATATAGATCAAATGAAGATAGCTTATCACTTT
TTAGCTTAAATTAGCGGATCATAGAGACTAATGAATGATCATTTCCCATAATTTAAAACA
GCTTAAAAAGACACTACACAAAAATTAGTATAGCAAGCAATCATGCTTTTTAATAAAGCA
ATTACTCAAAAAAAACTAGGACATATGGAAAAACCAATTTAATGTGCCATGGAAATAATG
AATATTAGCGACGATATAAGAAATAAATTGCAAGAAGCCTCTCAAGCACTCTTTGTTCAT
TTAGGATCAATTGTTTAAAAGTTCGACATGAAATTCAGCAGCTGCTCTTCATAGATAAAA
AATTGTTTGATCCCAAAATACGAAACAGCTAATAAGGACTTATTTAAAAGCACAACAGAA
GATGAATTCTAAATTGTGAAGAAAAAAATTAATTCAATCCAAAAAATCTTTAAAAAGATC
ACTATGAAGTATTACTAATCATTCAAATTCTTTTAGAACTCAGTGACAAAGAGCAAAATC
GCATTGGAGATTTTTATTGAAGAAGTTATGAAGTTCACACAAGACCAAGTTAATGAATTC
AGAAATCCTACAGGAATTTTAAATGGCTTATTCACTTTAAAGCAGTCTTCTATACTCTTA
AAAGACTACACTAATAAAAAATTTGACGAAATAGCATTTTAGGAAATGATTTCTCTTATT
TGCAACAATATAAACACAAAATTTTCTTTAATAACTAAAATGGTAAACAGCATTCAAATC
CCTAATAACATTGATGATACTTACAGAAATATTGAGGAACAAATCAAGAATATCAGCCAT
TTACTCTAATTCATTTAAAACCTTTCAAATTATATTTTAAATTTTGAAGATAAAAATCAA
AACACAATTGAGTCTCTTATTCAAATGGTTACTAATTGCTAGAATGGATTTGCTTAATAA
TTATTCAACAAGCTTAAATCTAATATGTATGATTTCGAACATTAAAAGCTACCATCTGAT
GCTATGAGATAAAAGATCATTCTCGATTAACTATAAAAACTTAAAGAATACAATTACAGC
TATTCTCTACTTAAAGTTGATCTATACGAACATGTCTTAGAAAAATCTATTTCTGAGTAA
TCTAGACTTATTAAGGAAATCAGTGACTATTTGTCAGACAATCCATCTTTACCTGATGAT
TTTAATTAAGAAAGTGCTTAGAAAAATCTTACTTTGATTAGATAAGCCGGAGTACTTTAT
CTAACCCATTTCATTGGAAGACTAGATAATCCTGCTGATACTCTTCAAAGTGAATTGACT
ATGAAATAAAAAGGATTGGATAAAAAAGTCAAAAGCATGGTTAAGCAATCTGATTATGAC
CAAATATTAGAGTACATGAGAACCATGAGTGAGGATAACGAATCTTATAAATCAATAAAG
AAGATTTTAAAGGAGAAGGTTAATATGCTCTTCGATTAAATAATTAAATCCTTCACCAAA
AGAAATATTTTGGATGACATTTATATTAATAAAATTAAACAAGACATAAGAAATTTAGAA
TAATCTAAATAGAAGCTGTCACAAATTAAATTCAAAAATTTTAGCATTGAAAAATTCTTC
CCTCAAATAACTCATCACTTGACTGCCTTTTTATAGAAATAAGTAAAGAGATTTGAAGAA
AAAATAGCTACTTAAAAAGTAGAGAAGGCCAGCCGTTGCTTGATGGTTGTTTGTAGAGTT
GTGTAGAATTTTTAGAGCTATATTAGACCCGAGGATAACTAACTACCTGATAAAATGATC
AACCAAATGAAGCTCTGTCTGCGCTAAATAGAAAACTAAATTGACATTAAAAACAAACAA
CAAACAACTTCCATTCTCCAAGTTCTTTAGGTACTAGTACAGAACTAACACCAATACAAG
GATGAATATAATTTAATCTTATAAAAAGTGAATAAATAAATTTTGGAACAAGCAGCAGTG
TTCGTAAACACAAAGATAGATTCATAAAACGAAGAAATAAGCGTCCAAGCTATAGCTGAA
ACTCTTAAGGGTGAATATTAGTATTTACTTATGTACACTTTAGATAACTATAACTAGCAT
TATCTAGCTTTCTTCTAGCCCATATTGAAGAGAATTTAAGATGAAATGTTAGATGTGAGA
AATATGTTTACTCAACGTAAGATTACAAACATCCTCAATTTAATTAATGGATCTAAAAGT
TCAATAGTTTAAAAAGAGGTCTGTAATTAATACAATAATCTCTGTGATACTTTCTTTGAT
TTACTCCAAAATAGAAATTATAATGGCACTTAAGAACTTCTCAAATTCCTCTCATAAATT
GCTGACGGTATTCGTTCTTTCTCCTACAACTCCTTGAAACAGAAATATTTTGAATTGTAA
GTTTGCATAGAGTAAGAATTTAATAGGTTACAAACTTCAACTGTACAAAGTCTAAACTAA
ATTGTTTTTGAGAGAGAATCTGAAGGAATTTATGATGTTGTTTAATTTTATTAATTCAAC
TCCTTAATGGCTTAATTTAACTTTTAATATGTCAAACATGAATAATTCAATACATAATCT
TGCCAAGTCTTCGATAAAATATAAAAATAATTAAAACAGTCTGTATCTCTTTTGCAGCAC
ACTGTCTTTAACAATACAGTAAAACTAATTGATTTCATTGAATAGACAAGGGTAAGTTTG
AATGATTAACAAATTAATGTAATCTAAATCTACAAGAAATATTTATCTGATATGCAATCA
ACTCATTCACATGTTAGCAGCTTCAACGATCTCAATAAATTAGTGAATGATGGATGCTGG
ACTATCTAATAAGTTATATCTGATTTACTTAATGCAAAGAAAAATGAAATTGTTAATGGA
ATCAATTCGTTACTTATACAAAAAAATTACAAGGAAACTTCAAGAATTTTAAGGTAAGTA
GAGGAGTTCTCAAAGAAAATTTAAGAGAGCTCTGTTAATATGAACACTTCAGACATCATG
AAGGTAGTATTTAGAAAATACGAAGAGAAAGCAATAGAAGCTCAAAGAAGATCAAAGGAT
AAGTATGATTCTAAGCTATTTGCATTGATAGAAGATTTATCTGAAATAGAAAAATATTTT
AAGGAAATCATAGTTCAAATCTCCAACTATAATGCATCAGAAGAAATAATCAACTAAATT
AAATTATCTATAGCCCAATTAACTAAACAAATTTATTCCTAAAATTTCGAGGATGAATCA
GACGTGAGAGAGTTTGTTGCATCTATTATTAATATCAGATAAATAGCATTCGAAATAGGA
CAAGTCCATGAATTCACTCTTGAATAAATAAGTGAGCTTATCACAACTAAATTTTAATAA
TTTACACCTCAATTCATTTCAGATGTTTCATCTAAGTTGAGATAAGATAAACTTGGTTTA
TTGATAATCTAGGAAAATAGTAAAAACTTCGAAGGTCTTCTTAACAAGATGATTGAGGAA
CTTTCCAAGAATTAATTCAGCTTGGAATATGTAAACAATAATATTAAAGGTGAAAAATTC
ATTGCAAGTGAGTTTTCAATCCAATATAAATATTATGAAGAGTGCTGGAAAAACCTCCTA
AGCAAGTGGCACTAAGGAGATCTCAAAGCAGAAACTATTTTATAAAAGACAAAGTCTTTG
TTTAAAAAATTCTGCTCATCCTACTAAGTCGATTACTTGAATCAAAAGTAAATCACTTGG
TCAGCATCATAGAAGTAAGATCTTTCTATCATGCTAGCTCACTTGAGTACTTTCTGGTCT
ATAGTAAACTGCCAAAGAAGAGAAGACAGTTTCAGAAAATTGCATCCTGTAAATAAATAT
TAAATTAAATAAAATTTTTAACAACATTTACTTTAATTAATTAAGTTTCTGTTGATTTTA
ATCTAATTCCATTTTCATTAATTTAAAGGTTTAAGTTTCAACTGTAATGAGATTGCTCTC
AATAGATACAACAACTACTTAGATGCCTATTGAAAACCATCTAGTTTAGGTAAAGACAGG
TGAAGGTAAATCTATCATTTTGGGAATTACTTCTTGCTTCTTAGGCTTACTAGGATTCTA
TGTAGATTGCTGCTGCTACAGTAATTATCTAAGTTAGCGTGATTTTTAGAGCTTCAGTCA
TATTTTCTAGCAATTAGAAATTGATAATGTAATTAAATATAACACTTTTGAGAAATAATT
CGAAGATATAATTAATGATCCAGAAGATATGAGATAAGTCGGTTTAGATTTACTTGATAA
TAAGTTACATAAAAAGGTACAGATATAAAGATAAGGGTCTTTGGGCAGTTAACCAAAGAG
AAGAATTCTTCTTATTGATGAAGTAGATTTCTTTTTCGGTGAAGATTTCATTGGTCGTAC
TTACCCTGTTGCACTCTATTACAATAATCAAGATGTTATTGATATTTTGAAATATATCTG
GTAGAATAGAGCTGTTCATATCGATAAGTTTAAGTAAACACAAGTATATAAAAAGCTATT
TTAGAACAATCCAAATTTAGTTCCTTGGTAAGCATTTATTGATGAACGTATAAAAATGAT
GTACGAAGATGTAAATAATCTTGAAGGCCACAGATATTTGACATATACTCCTTCTGGAAA
AAGCAAAACAATTATTTGCTATAAATCTCTTGATGGCATTTCCTTCAATACAGTCAAAGG
ATACAAAACAGCTTTTGCTTATATCTAAGAGTGGGAAAAGAAGAATATAACAGAAGATGT
TATGAATGAAAACCTTTCATTTATAATTAATGTAGGCTGCTTCTCATTCGCTTAGATACC
TTAGGAATATCAACTGGTATTGGGAGTCAGTGGTACTTTAGAAGATATGAGTGATTATCA
GAAAAATTTAACTAGAAATCTCTTCAACATAAGAAAATTAACAATCTCCCCATCAATTTA
TGGGTAGTCTAAATTTTCTTTTAAAAAAGAAAAGGACGTAGTTGTAAAAGAGAATAAGTT
CCTTTATCATTTAGAAATATAATCTCAAATAGAAAACGTTATGAAGTAAAATAGATCAGT
AATAGTATTCTTTGAGTCGAAGAGGGCATTAGACATTTTTAAAAATGAGTTTAAAACATA
ATACGATTATTAAGTTCTTTCTGAAGAAACTAATTTCAAAGGACACACAATAGTTAAAGC
AGGTTCTATGAGCATGATAACACTCGCAACAAAGCCTTTTGGTAGAGGCTGTGATTATAT
CAGCACAGATCCTGAGCTGGATAAGAATGGTGGTATTCATATTATCTAAACCTTCCTCTC
TGAAGATCTAGCAGAAGAGACTCAAATAAAAGGTAGAACTGCAAGACAAGCTTAATGTGG
TAGCTACAGTTTAGTAGTCAACAGAGAAGATCTTGTACTAAACTTTAATCTAAATGCTAG
TGTTAAAAATTTCTCTTATGAATTCTTACACCAATTGAGATAAACCACCTAAAAAAACAA
AGAAAAATCTTTATCAATAAAGCTTGAAGAAACAAGCTAATCTCACAAGGAATCTATGCG
TCTAAAGCAAATTTTGCTAAATTATTCTCCTAATAACAATGAAGAAATACAAGAAATATT
AATCAAATTTAACAGGGTCACAGACAGAACTGAGAATAAAACAAATATGTATAATTTCTA
TAGTGATTTAGCAGGTAAAATTGGTATCTATGAAAATAATTTCGAGTACGACGAGTATAA
CAATCCTAAAAATGTTGGTTTGGGTAGTGACAATTCATATAATGATCTATCACTATTGAT
AGGTCTATTTTATCCAGAAGAAGGACTAGATGAAGACATTAATCATTTATTAATACCAAC
ATTAAGAAAGAAGGGTTTCAAAGTTTGTGAAGTCGTTGTTACTGAGCAGGAATTTATCGT
AAAGCTACCTTAATTCGATTAAGCTTGGGTTATAAGTGGATATAAGTTCCACTCTCATAG
AATGGAAAGCAGATTCTAAGATGCTATAGAATATCACTTGAAACAACAAAAGGGTTTGAT
GATTTGGGCTGATAATAATCCTTATATTGTGCATGCAAATCTGATACTTTAAAGAATTCC
AGTTGGTTATTATAATAGATAACCTATCTTTATTAAATTAGATGGTTCTGATTATGGTGA
TTAGGTCTTAAAGGCTGGTGATTACTTTGAAACTTAATAGTTCGGTCCACATTTAATTAC
TACTGGTATCAATAATCTCCACGAGGGTATTACTATCTGCTATCCTTAAGTACTGAGCAA
TACACCAAAAGATAACTTTGGCCATCTTAATATTATCGGATTAAGCAGTGCTTCCAAGCC
ATGTTTCTTTGTGCTCTCCGGAACAGAGGATAGAGGTAGAATTGTATTTGATTGTGGTTT
TACAAAACTAATGAGAGATTAATGGAACACTGCTGGTACAGTTACCTATGTAACTAATTG
TTATGCTTGGCTATATTGGAAGGAAAGATTCGTATAAAATTTATGA