Identifiers and Description

Gene Model Identifier

TTHERM_01216140

Standard Name

DCR1 (DiCeR 1 )

Aliases

PreTt28880 | 277.m00034 | 3823.m01226

Description

Dicer-related RNase III protein; one of three Dicer-like proteins described in T. thermophila

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01216140

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD01928 ) Micronucleus: homozygous KO of DCR1 with neo3 Macronucleus: Loss of part of DCR1 locus and of the neo3 used to KO.
  • ( SD01929 ) Micronucleus: homozygous KO of DCR1 with neo3 Macronucleus: Loss of part of DCR1 locus and of the neo3 used to KO.
  • ( SD02833 ) Micronucleus: Nee3 cassette into DCR1 locus
  • ( SD02834 ) Micronucleus: Nee3 cassette into DCR1 locus
  • ( SD02158 ) Micronucleus: heterozygous KO of DCR2 with neo3
  • ( SD02177 ) Micronucleus: homozygous KO of DCR2 with neo3
  • ( SD02178 ) Micronucleus: homozygous KO of DCR2 with neo3
  • ( SD02179 ) Micronucleus: heterozygous KO of DCR2 with neo3

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10671.12.9990837046884738e-127hypothetical protein (698 aa)
WormBaseWBGene000009390.0000000000006997872742366828locus:dcr-1 Endoribonuclease
dcr-1 status:Partially_conf
irmed UniProt:P34529 prote
in_id:CCD71200.2
SGDYIR002C0.00020003864201578029MPH1 Member of the DEAH family
of helicases, functions in an
error-free DNA damage bypass
pathway that involves homologo
us recombination, binds to fla
p DNA and stimulates activity
of Rad27p and Dna2p; mutations
confer a mutator phenotype

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16357212: Lee SR, Collins K (2006) Two classes of endogenous small RNAs in Tetrahymena thermophila. Genes & development 20(1):28-33
  2. Ref:16199890: Malone CD, Anderson AM, Motl JA, Rexer CH, Chalker DL (2005) Germ line transcripts are processed by a Dicer-like protein that is essential for developmentally programmed genome rearrangements of Tetrahymena thermophila. Molecular and cellular biology 25(20):9151-64
  3. Ref:15598983: Mochizuki K, Gorovsky MA (2005) A Dicer-like protein in Tetrahymena has distinct functions in genome rearrangement, chromosome segregation, and meiotic prophase. Genes & development 19(1):77-89

Sequences

>TTHERM_01216140(coding)
ATGGATTTCAGTCAGTTTAAAGACGAAAGTAGCTCTGAATCCAATTTTGAAGAATAAGAT
AGAGTAGAAAGCTTCTTGAAAAAGAATGAAACAATTTTAGATTATAGCAGCATTGATTAA
ATTTAATAATCCTTTAATTCATCAGATTTGGCTATTTTATAATCAATTCATAATAAAATT
GGTAATCAAAATAGCTTATTGCTCAAAAATATAGAAATTGCTCAAAATCCTGAAGGATTT
AATAAAAATTTGAATCCTGGACAGAAAGATGTTGAAACTAAATAAATATAAAAAGGTGAA
GCTATTGAAGATAAATAAGAAAGTTTGGTTTCATCTCAAAATTAAAATAAAAAAGTGCTC
AAAAATAGCTAAAATTCAGATTTATTGAATGATCAACTTGAGGCGCCTTCTTTATCTAAT
TAAAAAAATCAATAAGATTTTTTGTAGGAAAAATCAAAATTAACATCCCTTAATGGATAA
AATATTATTTAGAATTAATAATATTAAAATTTAGAGTAAAAAAATTAAGTAAAAGATAAT
ATTGAAGAAGAAAGCTTAATTTTATCTTAACCATCAAATAAATAACCAATTGAAAACAAT
AAAAGCTTTAACTAATAGGAAACATTAAATACTGAGTTATAAAATTAGTAAAATATTATT
TCGTAGTAATAATTTCCAATAACTCAATAAAATATTATTTAGAATTAATAAAATTAAAAC
TTAGAGTAAAAAAATTAAGTAAAAAGTAATATTGAAGAAGAAAGCTTAATTTTATCTTAA
CCATCAAATAAATAATCAATTGAAAACAACAAAAACTTTAAATAATAGGAAACATTAAAT
ACTGAGTTATAAAATTAGTAAAATATTATTTCATAGTAATAATTTCCAATAACTCAATAG
AATATTTCTTAGAAAGAAGAAAGCTTAATTTTATCTTAACCATCAAATAAATAACCAATT
GAAAACAATAAAAACTTTAAATAATTGGAAACATTAAATACTGAGTTATAAAATTAGTAA
AATATAATTTCGTAGTAATAATTTCCAATAACTCAATAAAATATTATTTAGAATTAATAA
TATTAAAATTTAGAGTAAAAAAATTAAGTAAAAGATAATATTGAAGAAGAAAGCTTAATT
TTATCTTAACCATCAAATAAATAATCAATTGAAAACTAATAATTTCCAATAACTCAATAA
AATATTTCTTAGAATTAATTATATTAAAATTAAGAGTAAAAAATGATAATAAAAGATGAT
GTTGCTAGCAATACTTAAGAAAATAGAATGTTACCTTAATTAGAAAATCAAAAAATTACA
AAAAATAACCAAAACGGTATCTAATAGCCTATATTACCTCTTTTATTATCTATGTAAAGT
AATTAGCAGGATTAATAAAGTAGTTTTTAGTCATAAAAATCTACAATAAATTCCTCTAAT
GGATTGAAAATACTTTAGAATTAATAATATTAAAATTTAGAGTTAAAAAATCTAGATAAA
TAGGATATTGATTAGAATAATGAAGATTGCTCAAAAAAGTTTTAAATAAGTAATCAATAA
CATTTTTAAAATAAACAAAATTGCAATCTTGAGCAAATATTACCTTTCCCTCATTTTTTA
CCTAGCCAAAGTGATTAGGATTTAGAAAGCATTGTTATAATTGATTAATCTTCAAAAATA
GATTCTTCTAATGGATTGAATATCCTTTAGAATTAATAGTGTTAAAATTTAGAGTAAAAA
AATCTAGATAAATAAGATATTGCTTAAAATATCAGTGATAGTTCAATATCGTCTTAAAAA
GATAACCAAAAACTTTTTTAAAATAATCAAAATTGCATAGATGAAAGCTCAGTTTAATCT
TAAAGAAATTAATAAACTATTATTGAAAATGTTAATTAACAAGAAACAAAAACTCATTAT
TAATCTAATCAAATTAAATAGCAGAATGAATAAATGATATCATTAAATTAATGTCTAAAA
AAATAATCTGAAAATAAAATTGATTATGATAATAAATTATTAAACCTTTAAGAAAATCAG
ATAAATTATTGCTAAAAAAAATTAATTACTCAATAACTAAGCCAATAACAAAATAATAAT
CCAATTTAATAAAGCAACTATCAATACAATAATAACAATAATTTAAATGGTAGTGATTAA
ATTTAACTATAAATATCTTAAGAAAACATTTCATAATAATAAAGCTCAAATGATAACTTT
ACAATTAGCTCTACCCAAAAATAGTTTGGATAGAAACTTTTAGAAGATTAGAAGAATATT
CAAAATATCTCAAACTAAATTGACTGTTTAGATTTAGATAGTTAAAACATTATTTAAAAT
TAAGAAGATGAAAATAGATAACTTCAATTTTCATCAGAAGACGAGGGTGATAACGAAGAA
AAAAAAACTTCTCAAGACTAAAATATATTAAAACAACATTAAGAATTGTTAGGAGAGCCT
ATAAGTAGTATAAGCAATGTAGAAATTGATAGCAATTCGTCATTTTTAGATGAATTTGAA
TTTTTAGAAAATAAAAAGCATAGTGCTCTTTATTAAAAGAGCAAAAACATAAAAGATTTT
TGCAATATTCTGAAAAAACAAAAGTAACTGAAATAATAATATGTCTAAATTGAGCCTAGA
GATTACTAAGAGGAAATATTTAAAAATCTTATTTAAAATTATGGAAATTACATTATATTT
TTAGAAACAGGAACAGGTAAAACATTAGTAAGCTAAATGATAGCTTAATACACTCTTTCA
AAGTTCAAAGGGTCTAAGGTTGCATTTTTAGCAAATCAAGTGAACTTAGTGGAATAACAA
TATAATAATTTCTTGACGTATCAAAGATCAATAGAAGAATATTTAGTCAAACAAAATTTA
TCTGAAGAGATAAATTAAAATATTAACATCTCTTTTTTCCATGGTAAAATGAATTTAGAC
TTCTGGAATAGATCGTTTTGGTAAAAAAATGTTGAACAATCACAGATTATTTTTTTTTCT
TCTTAAATTTTTTTGAATGGATTGAGAAGAGGTCATTTCCAGCTCACTTAATTTAAATTG
ATCATATTTGACGAATGCCACAATACTAGTAAAGAACATGCTTTTTCTTAAATTATGAAA
GAATTTTACTTTTAAGTAAAGAAAAATGATATTGTCTTAAAAAATACACCAAATATTATT
GGATTGTCTGCTACTCCTATTACACAAGGAAATAAAGGAAATTTTAATGTGAGAAGAGAA
ATGCTAAAATTAGCTCATAATTTAGATTGCTAATTTATTAATTATGATTTACAGAAAGTC
TATGCACAGTTAAGAAACATTAAATAAACTGAGAAGTTTTATGAAGTTAATATGAATGAG
AATGATTATCAATACATTGAATCTAACAACATTAAAGGCTTTGATCAGGCTGATAAAGTT
TTATATGAGCTATAAGAGTAATATCCTGAATTAAAGGAGCTATATAAATAGTTATAAGCG
CTTAGCAGATTAGATAATCTTGCTTCTAAAGCCTTTACTCAAATACTTAGGAAAATAATT
AATCTCTTAGAAGAATATATCATTATTTTAATTTATCAAATAGGTGTTTATGTTGTGCAA
TTTTTTATCTTCGATATCTTGTAAGAACTCAAAGGTGTTAACATAACTGCACCAAAAACT
CTCTGTATGAAACAATAGCTGGAGGATATCTTACAATAATTTTATGAAATATTTAGAGCA
AAATACAACAATATTAATAATGATCTTAGCAATAAATCATAAGTTTTGCTATCAATTCTT
TCAAAAAGTGAAGGTATTTCTTTGATATTTTGTAATAGCAAAGTTGTTGTCAAATATGTC
ACGAAGTTCATTTAAAGTGTATTCTAAAATAGTAATTCAGACTAAAAATGTTGCGAATAT
ATAATGGGATAAACAAGCCAAAATAAAAAAGATGAAGAAGATGATAATAATTTAAAAATA
ATAAATAGCATAAATCCGTATGAAATCTAAAACTTAAAATCGTAAAGTGTATAATAAGCT
TAGAACATTATACAACAAGAAAAATAATTTAGTATCAAATTTTATGCGCTAAAATAAAAA
TACTCTGAACAATAAAAGATTGTTGAGAGATTCAGAAACAAATAATTCAAAATTTTAGTA
AGCACTAGTGTTGTTGAAGAAGGTTTCGATATTCCTTCATGTAATATCGTCATAGCTTTT
AGCAAAATAATTAGTCAAAGATAATATATACAAATGAAAGGTAGAGCTAGAGCAGAAAAT
AGCAAATTTTATGCCTTAGTTGCTGTTTACAATAATAATAAGATAAAATTATAAAACCAT
TAAATAGTGAGTGATTAAATAAAATAAGAATACTATAGCTTATCCTTATTGACCTAAAAG
TAATTTAGTTAAGAAAAAGAAAAGCATTAAGTTAACGATGAGGATGATACGTCGATGGAA
AATTATGAAAATTTCATTATTCCAGAAACTAACGCAAATGTGAATACATTTTGGGTTAAA
GAAATTGTCAACTAATTTTGTCAATCGTTTTGCTACAATAGTTAGTTGGACAATAGATTC
CCAATAGTTTTCGACTGTTTAATTAATGAAAGAGGTTAGTATTTGTCTCTTATCATTTTA
CCTTTTCAACTCTAAGCAAATATTTTTATGAATCTCCAGAAGCTAAAATTTAAAAAAGAA
GATGCTTAAAGATGTGCTTTTATGCAGGCAGTCAAGAGCCTATTAAAAAACAAATATATC
TCAAATGAGCTAAGACCGAGACATAAATCTTACAAAAATTTCTATTTTGGAAGAGGTGAA
GATGATTACTATGTTGAATACTCTGATAGATATTTTGCTATTATATAAAAGAACATGCAG
GAAGTATTTGTAGGATATTTAAATGGAAAAAAGAGATAAATTGTTGTCTACAAAAAACTT
TATCGTTAAATTGTAGATGAAGTTTTTGTTTAAAAAGAATAAATCTAATAAAGAGAATTT
CATCCCTTTTATCTCTATGATATATAATACAAGGGTGAATTACTTTAAGTTAAACTTATT
TATGACAAGCAGTGTTTAGAAGGCTTTATCCATTAAGATATTAAATTTATCTTCCATAAC
TAAATTAATTTAAGCAATGAAGAATTAAACGAAATTAGAAAAATTAACCAATAAGCTCAT
TTAAAGTTATTAAATCTTGATAAAATGAATCTTGAGCCTAAAAAAATTTACACTAGCAAA
TGTTTAATTTATAAAAAAACATAAATCTTAGATTATAAAAACACAGAAGAAAGTGTGCTA
ATTAATGAAAATGTGGTTTTTCTTTACATAATGAGTGATCTGAATTAAAATTAGATCAAA
GAAATTAAATAAATAAATAACCACATTGATTAAATTAGAGATTTTCTTAAACTTAAAATT
ATTTCTGAAAAAATATCAAAAAAACTTAACTAAGAAATAATTGATTTTTAGAATATGCAA
ATAGAACAATTAAATGTTTTTATCAAGCCAAATTTTAAGCTTACTGGTTCGCTCTCTAAA
TCAAATATTAAACAAGATTAGAAAGAAATTTATCCTCTTTAATTTGAGAATCTGTTAACC
TTAACAGAAAGAGATTTAATCTAAATTTTTTAGAAAAAATAATTAGAGAAAAACCTTGTG
TTTTTAGGAAAGTAATATTTCAGATTTATAACCAGCATTAATGTTTTCAATGAAAACTTT
AAAACACACTATGATATTTTAATAAGTGAACTAGATATGAGATTTAATGATTGCTTTGTT
ATGTCTAAAGCAGTAGAGTCTAAGTTTTTTAAGTACTTGCTGATCAAAGACTATGTAACT
TTGGCTCCTTGCTTGAGTATAATTTCATAGAAATTACATACGTTTGTTGCTGATCAGTTA
ACATTACAAGAAAAAATTCTTATCAAAAATCATTAATAAAATCCATTAAATTATAACATG
GCAGAAATTAGAAACAAATAATTTACAGAAATAATTTATTATATAATAGGAATTACCATA
AATCAAAACCAAAACATTTTCAAAAACTTTGAAAAATATAGCTCATTATTTTAACCTCTT
CTTAAATCATTTAACTTGATTGAAAAGTATAGTGTTTTAACCAAATTCGTAAATATCTAA
CCAGAATAGATTTAGTATAAACCTGATAAATAAAATTTATTAAATTAATTTAGCTAGAAT
TCTATCAATTACAAATTTAATAACATAGGTCTTCTCTAATAGGTATTTACTCATTCTTCA
TATAAATAAGATATGGTTTGTTCAGATCTTAATAAGATCTTTGGAACTCTAGAAAAATCT
TTGAATGACTTCATCACCGAAATATAAAAAACAGAAAAAAGATAATCTTTTATACAGCTA
AATGATGTTTCAAATGATGTACTTTCATTTTTAGGATCTATAATATTCTCTCAAATAGTC
TTAAAGCGACTTTACACGAGATACAGTCAATCCAATCCAAATGAATTAGATATTTTCATG
GAAATAATATGTTGTGAATAAACAAAGTCTTTCTTGTCTGCAAAATTTAAATTAGATTAA
TACTTCATTTATGGGATTCAATATTAATAAATATTTTAAAAAATAAATCATGCAGCTAAT
TTTTTGAGATAGTAAAACATTTAGAGTTTCAGAAATATTGCAACTAACTATAATAAGGAT
ATAAGTATTTTATCTTAACTCTTTGACTCTTTGGTAGGAGCTATATATATAGACTTACAA
TAAGATTTTGAAAAAACATCAGATTTCTTTAATTAAAATTAACACATATAATTAATTATA
AAAGATATTTGCCAAATAGCAGATTAGTATCCTAAATATTCTTTAATTAAAGTTTTAAAA
TAAAAGGGATATGATTGGGAAGATATTCAAATTATTAAATTACCACATCCAGAGTAGTTC
TTACCAATTAATTAGAATAAATATAACTTCTAGATTTATGATATTAAAAATGAAAAATTA
CTTATTGATAAGGTTTTTGAATGCCAAAGAATCGAAGAGGCATATTTGGCTATCAAAGAA
TAAATCATTAACAACCCAATAAATTAATAGTCTTTATGA


>TTHERM_01216140(protein)
MDFSQFKDESSSESNFEEQDRVESFLKKNETILDYSSIDQIQQSFNSSDLAILQSIHNKI
GNQNSLLLKNIEIAQNPEGFNKNLNPGQKDVETKQIQKGEAIEDKQESLVSSQNQNKKVL
KNSQNSDLLNDQLEAPSLSNQKNQQDFLQEKSKLTSLNGQNIIQNQQYQNLEQKNQVKDN
IEEESLILSQPSNKQPIENNKSFNQQETLNTELQNQQNIISQQQFPITQQNIIQNQQNQN
LEQKNQVKSNIEEESLILSQPSNKQSIENNKNFKQQETLNTELQNQQNIISQQQFPITQQ
NISQKEESLILSQPSNKQPIENNKNFKQLETLNTELQNQQNIISQQQFPITQQNIIQNQQ
YQNLEQKNQVKDNIEEESLILSQPSNKQSIENQQFPITQQNISQNQLYQNQEQKMIIKDD
VASNTQENRMLPQLENQKITKNNQNGIQQPILPLLLSMQSNQQDQQSSFQSQKSTINSSN
GLKILQNQQYQNLELKNLDKQDIDQNNEDCSKKFQISNQQHFQNKQNCNLEQILPFPHFL
PSQSDQDLESIVIIDQSSKIDSSNGLNILQNQQCQNLEQKNLDKQDIAQNISDSSISSQK
DNQKLFQNNQNCIDESSVQSQRNQQTIIENVNQQETKTHYQSNQIKQQNEQMISLNQCLK
KQSENKIDYDNKLLNLQENQINYCQKKLITQQLSQQQNNNPIQQSNYQYNNNNNLNGSDQ
IQLQISQENISQQQSSNDNFTISSTQKQFGQKLLEDQKNIQNISNQIDCLDLDSQNIIQN
QEDENRQLQFSSEDEGDNEEKKTSQDQNILKQHQELLGEPISSISNVEIDSNSSFLDEFE
FLENKKHSALYQKSKNIKDFCNILKKQKQLKQQYVQIEPRDYQEEIFKNLIQNYGNYIIF
LETGTGKTLVSQMIAQYTLSKFKGSKVAFLANQVNLVEQQYNNFLTYQRSIEEYLVKQNL
SEEINQNINISFFHGKMNLDFWNRSFWQKNVEQSQIIFFSSQIFLNGLRRGHFQLTQFKL
IIFDECHNTSKEHAFSQIMKEFYFQVKKNDIVLKNTPNIIGLSATPITQGNKGNFNVRRE
MLKLAHNLDCQFINYDLQKVYAQLRNIKQTEKFYEVNMNENDYQYIESNNIKGFDQADKV
LYELQEQYPELKELYKQLQALSRLDNLASKAFTQILRKIINLLEEYIIILIYQIGVYVVQ
FFIFDILQELKGVNITAPKTLCMKQQLEDILQQFYEIFRAKYNNINNDLSNKSQVLLSIL
SKSEGISLIFCNSKVVVKYVTKFIQSVFQNSNSDQKCCEYIMGQTSQNKKDEEDDNNLKI
INSINPYEIQNLKSQSVQQAQNIIQQEKQFSIKFYALKQKYSEQQKIVERFRNKQFKILV
STSVVEEGFDIPSCNIVIAFSKIISQRQYIQMKGRARAENSKFYALVAVYNNNKIKLQNH
QIVSDQIKQEYYSLSLLTQKQFSQEKEKHQVNDEDDTSMENYENFIIPETNANVNTFWVK
EIVNQFCQSFCYNSQLDNRFPIVFDCLINERGQYLSLIILPFQLQANIFMNLQKLKFKKE
DAQRCAFMQAVKSLLKNKYISNELRPRHKSYKNFYFGRGEDDYYVEYSDRYFAIIQKNMQ
EVFVGYLNGKKRQIVVYKKLYRQIVDEVFVQKEQIQQREFHPFYLYDIQYKGELLQVKLI
YDKQCLEGFIHQDIKFIFHNQINLSNEELNEIRKINQQAHLKLLNLDKMNLEPKKIYTSK
CLIYKKTQILDYKNTEESVLINENVVFLYIMSDLNQNQIKEIKQINNHIDQIRDFLKLKI
ISEKISKKLNQEIIDFQNMQIEQLNVFIKPNFKLTGSLSKSNIKQDQKEIYPLQFENLLT
LTERDLIQIFQKKQLEKNLVFLGKQYFRFITSINVFNENFKTHYDILISELDMRFNDCFV
MSKAVESKFFKYLLIKDYVTLAPCLSIISQKLHTFVADQLTLQEKILIKNHQQNPLNYNM
AEIRNKQFTEIIYYIIGITINQNQNIFKNFEKYSSLFQPLLKSFNLIEKYSVLTKFVNIQ
PEQIQYKPDKQNLLNQFSQNSINYKFNNIGLLQQVFTHSSYKQDMVCSDLNKIFGTLEKS
LNDFITEIQKTEKRQSFIQLNDVSNDVLSFLGSIIFSQIVLKRLYTRYSQSNPNELDIFM
EIICCEQTKSFLSAKFKLDQYFIYGIQYQQIFQKINHAANFLRQQNIQSFRNIATNYNKD
ISILSQLFDSLVGAIYIDLQQDFEKTSDFFNQNQHIQLIIKDICQIADQYPKYSLIKVLK
QKGYDWEDIQIIKLPHPEQFLPINQNKYNFQIYDIKNEKLLIDKVFECQRIEEAYLAIKE
QIINNPINQQSL


>TTHERM_01216140(gene)
ATGGATTTCAGTCAGTTTAAAGACGAAAGTAGCTCTGAATCCAATTTTGAAGAATAAGAT
AGAGTAGAAAGCTTCTTGAAAAAGAATGAAACAATTTTAGATTATAGCAGCATTGATTAA
ATTTAATAATCCTTTAATTCATCAGATTTGGCTATTTTATAATCAATTCATAATAAAATT
GGTAATCAAAATAGCTTATTGCTCAAAAATATAGAAATTGCTCAAAATCCTGAAGGATTT
AATAAAAATTTGAATCCTGGACAGAAAGATGTTGAAACTAAATAAATATAAAAAGGTGAA
GCTATTGAAGATAAATAAGAAAGTTTGGTTTCATCTCAAAATTAAAATAAAAAAGTGCTC
AAAAATAGCTAAAATTCAGATTTATTGAATGATCAACTTGAGGCGCCTTCTTTATCTAAT
TAAAAAAATCAATAAGATTTTTTGTAGGAAAAATCAAAATTAACATCCCTTAATGGATAA
AATATTATTTAGAATTAATAATATTAAAATTTAGAGTAAAAAAATTAAGTAAAAGATAAT
ATTGAAGAAGAAAGCTTAATTTTATCTTAACCATCAAATAAATAACCAATTGAAAACAAT
AAAAGCTTTAACTAATAGGAAACATTAAATACTGAGTTATAAAATTAGTAAAATATTATT
TCGTAGTAATAATTTCCAATAACTCAATAAAATATTATTTAGAATTAATAAAATTAAAAC
TTAGAGTAAAAAAATTAAGTAAAAAGTAATATTGAAGAAGAAAGCTTAATTTTATCTTAA
CCATCAAATAAATAATCAATTGAAAACAACAAAAACTTTAAATAATAGGAAACATTAAAT
ACTGAGTTATAAAATTAGTAAAATATTATTTCATAGTAATAATTTCCAATAACTCAATAG
AATATTTCTTAGAAAGAAGAAAGCTTAATTTTATCTTAACCATCAAATAAATAACCAATT
GAAAACAATAAAAACTTTAAATAATTGGAAACATTAAATACTGAGTTATAAAATTAGTAA
AATATAATTTCGTAGTAATAATTTCCAATAACTCAATAAAATATTATTTAGAATTAATAA
TATTAAAATTTAGAGTAAAAAAATTAAGTAAAAGATAATATTGAAGAAGAAAGCTTAATT
TTATCTTAACCATCAAATAAATAATCAATTGAAAACTAATAATTTCCAATAACTCAATAA
AATATTTCTTAGAATTAATTATATTAAAATTAAGAGTAAAAAATGATAATAAAAGATGAT
GTTGCTAGCAATACTTAAGAAAATAGAATGTTACCTTAATTAGAAAATCAAAAAATTACA
AAAAATAACCAAAACGGTATCTAATAGCCTATATTACCTCTTTTATTATCTATGTAAAGT
AATTAGCAGGATTAATAAAGTAGTTTTTAGTCATAAAAATCTACAATAAATTCCTCTAAT
GGATTGAAAATACTTTAGAATTAATAATATTAAAATTTAGAGTTAAAAAATCTAGATAAA
TAGGATATTGATTAGAATAATGAAGATTGCTCAAAAAAGTTTTAAATAAGTAATCAATAA
CATTTTTAAAATAAACAAAATTGCAATCTTGAGCAAATATTACCTTTCCCTCATTTTTTA
CCTAGCCAAAGTGATTAGGATTTAGAAAGCATTGTTATAATTGATTAATCTTCAAAAATA
GATTCTTCTAATGGATTGAATATCCTTTAGAATTAATAGTGTTAAAATTTAGAGTAAAAA
AATCTAGATAAATAAGATATTGCTTAAAATATCAGTGATAGTTCAATATCGTCTTAAAAA
GATAACCAAAAACTTTTTTAAAATAATCAAAATTGCATAGATGAAAGCTCAGTTTAATCT
TAAAGAAATTAATAAACTATTATTGAAAATGTTAATTAACAAGAAACAAAAACTCATTAT
TAATCTAATCAAATTAAATAGCAGAATGAATAAATGATATCATTAAATTAATGTCTAAAA
AAATAATCTGAAAATAAAATTGATTATGATAATAAATTATTAAACCTTTAAGAAAATCAG
ATAAATTATTGCTAAAAAAAATTAATTACTCAATAACTAAGCCAATAACAAAATAATAAT
CCAATTTAATAAAGCAACTATCAATACAATAATAACAATAATTTAAATGGTAGTGATTAA
ATTTAACTATAAATATCTTAAGAAAACATTTCATAATAATAAAGCTCAAATGATAACTTT
ACAATTAGCTCTACCCAAAAATAGTTTGGATAGAAACTTTTAGAAGATTAGAAGAATATT
CAAAATATCTCAAACTAAATTGACTGTTTAGATTTAGATAGTTAAAACGTAAACAAATTT
AATTTACTTGATGGCAATTCCTCAAATAATATTAATAAAATAATTTAAACTAGATTATTT
AAAATTAAGAAGATGAAAATAGATAACTTCAATTTTCATCAGAAGACGAGGGTGATAACG
AAGAAAAAAAAACTTCTCAAGACTAAAATGTAAGCAAAAAACTCATTTTTATATTTATTT
ATTTTTTATTTATTTAATAATTTAATTTCTTTATTAAATATAGATATTAAAACAACATTA
AGAATTGTTAGGAGAGCCTATAAGTAGTATAAGCAATGTAGAAATTGATAGCAATTCGTC
ATTTTTAGATGAATTTGAATTTTTAGAAAATAAAAAGCATAGTGCTCTTTATTAAAAGAG
CAAAAACATAAAAGATTTTTGCAATATTCTGAAAAAACAAAAGTAACTGAAATAATAATA
TGTCTAAATTGAGCCTAGAGATTACTAAGAGGAAATATTTAAAAATCTTATTTAAAATTA
TGGAAATTACATTATATTTTTAGAAACAGGAACAGGTAAAACATTAGTAAGCTAAATGAT
AGCTTAATACACTCTTTCAAAGTTCAAAGGGTCTAAGGTATTTATTTATTTTTATTTTAG
ACAAAATAAATCATAAAAATACAAAAAAGTATAAATATATAAAATGTAAAGAGGAGGGAG
GGATTTATAGATAATTCTATGAAAAATTAAAGAATTAAAGAAATCTTGAATAAACAAACC
TAATCCAAATTTGTTTAATATTTGATTTTTTTTAAAATATAAAACAATTTTGTGTTTCTT
GGTTTTTTTCTATCTTCTCTTTTTTTGATAAATAGATATTTTTTCATATTAATATGAAGA
CAAAATTAATAGAATTTCTATTCAGATTTAGTTTTTAAAATATAAATTTTAGATATTTTT
TGAAAGAATTATGAAGAAAAAATTAAATTAAATTTGTTTTCAGATTAAATTTTTAAAATA
AAATAAATTTATGTTCAGAAAAAAATTAAAATTCAACACTAAAAATAAGAAAAAAATACT
TTTACAATCATAATATTTTTAATTCACTTAACTTTTACTTATTCTTATTAATTTAAAATT
TTAATTAGGTTGCATTTTTAGCAAATCAAGTGAACTTAGTGGAATAACAATATAATAATT
TCTTGACGTATCAAAGATCAATAGAAGAATATTTAGTCAAACAAAATTTATCTGAAGAGA
TAAATTAAAATATTAACATCTCTTTTTTCCATGGTAAAATGAATTTAGACTTCTGGAATA
GATCGTTTTGGTAAAAAAATGTTGAACAATCACAGATTATTTTTTTTTCTTCTTAAATTT
TTTTGAATGGATTGAGAAGAGGTCATTTCCAGCTCACTTAAGTAAAATTATTATTAAATA
TTTTGCTATATTTTAAATAAATAATTTTTTAGTTTAAATTGATCATATTTGACGAATGCC
ACAATACTAGTAAAGAACATGCTTTTTCTTAAATTATGAAAGAATTTTACTTTTAGTAAT
ATTTATTTTATACATCAGCATACAAAATTTTATTTATTTTATAATCATAATGATAGAGTA
AAGAAAAATGATATTGTCTTAAAAAATACACCAAATATTATTGGATTGTCTGCTACTCCT
ATTACACAAGGAAATAAAGGAAATTTTAATGTGAGAAGAGAAATGCTAAAATTAGCTCAT
AATTTAGATTGCTAATTTATTAATTATGATTTACAGAAAGTCTATGCACAGTTAAGAAAC
ATTAAATAAACTGAGAAGTTTTATGAAGTTAATATGAATGAGAATGATTATCAATACATT
GAATCTAACAACATTAAAGGCTTTGATCAGGCTGATAAAGTTTTATATGAGCTATAAGAG
TAATATCCTGAATTAAAGGAGCTATATAAATAGTTATAAGCGCTTAGCAGATTAGATAAT
CTTGCTTCTAAAGCCTTTACTCAAATACTTAGGAAAATAATTAATCTCTTAGAAGAATAT
ATCATTATTTTAATTTATCAAATAGGTAATTAATTTTATATTCAAATGTTTTATTTTTTA
ATATTTATTATTATTTTATTAGGTGTTTATGTTGTGCAATTTTTTATCTTCGATATCTTG
TAAGAACTCAAAGGTGTTAACATAACTGCACCAAAAACTCTCTGTATGAAACAATAGCTG
GAGGATATCTTACAATAATTTTATGAAATATTTAGAGCAAAATACAACAATATTAATAAT
GATCTTAGCAATAAATCATAAGTTTTGCTATCAATTCTTTCAAAAAGTGAAGGTATTTCT
TTGATATTTTGTAATAGCAAAGTTGTTGTCAAATATGTCACGAAGTTCATTTAAAGTGTA
TTCTAAAATAGTAATTCAGACTAAAAATGTTGCGAATATATAATGGGATAAAGTAAATAA
ATATTTATTTTCTTTGTATGTATATTTGATATATTACTTATTTTATCATAAACAGCAAGC
CAAAATAAAAAAGATGAAGAAGATGATAATAATTTAAAAATAATAAATAGCATAAATCCG
TATGAAATCTAAAACTTAAAATCGTAAAGTGTATAATAAGCTTAGAACATTATACAACAA
GAAAAATAATTTAGTATCAAATTTTATGCGCTAAAATAAAAATACTCTGAACAATAAAAG
ATTGTTGAGAGATTCAGAAACAAATAATTCAAAATTTTAGTAAGCACTAGTGTTGTTGAA
GAAGGTTTCGATATTCCTTCATGTAATATCGTCATAGCTTTTAGCAAAATAATTAGTCAA
AGATAATATATACAAATGAAAGGTAGAGCTAGAGCAGAAAATAGCAAATTTTATGCCTTA
GTTGCTGTTTACAATAATGTAATATTTACTTTTAATATTCATTCTTACTTACTTACTTAC
TTACTTACTTACTTACTTACTTACTTACTTACTTACTTACTTACTTACTTAATTATTTTA
TAAAAACATCAATTAGAATAAGATAAAATTATAAAACCATTAAATAGTGAGTGATTAAAT
AAAATAAGAATACTATAGCTTATCCTTATTGACCTAAAAGTAATTTAGTTAAGAAAAAGA
AAAGCGTAATTAATTTTTATTGAAAAATTATTATTTAATTAAAAATATTAAATTTTGTTA
TAAATTTAGATTAAGTTAACGATGAGGATGATACGTCGATGGAAAATTATGAAAATTTCA
TTATTCCAGAAACTAACGCAAATGTGAATACATTTTGGGTTAAAGAAATTGTCAACTAAT
TTTGTCAATCGTTTTGCTACAATAGTTAGTTGGACAATAGATTCCCAATAGTTTTCGACT
GTTTAATGTAAATATTTTTTTAAACATTTAAATTCATTTAAACAATTATTATTATAATGT
ATGTATGAATGAATCAATGAATGCAGTAATGAAAGAGGTTAGTATTTGTCTCTTATCATT
TTACCTTTTCAACTCTAAGCAAATATTTTTATGAATCTCCAGAAGCTAAAATTTAAAAAA
GAAGATGCTTAAAGATGTGCTTTTATGCAGGCAGTCAAGAGCCTATTAAAAAACAGTAAT
TTATTGTTAAGTTTTATTATCAAACGATTTTTATTTTATTAAAAAAGAATATATCTCAAA
TGAGCTAAGACCGAGACATAAATCTTACAAAAATTTCTATTTTGGAAGAGGTGAAGATGA
TTACTATGTTGAATACTCTGATAGATATTTTGCTATTATATAAAAGAACATGCAGGAAGT
ATTTGTAGGATATTTAAATGGAAAAAAGAGATAAATTGTTGTCTACAAAAAACTTTATCG
TTAAATTGTAGATGAAGTTTTTGTTTAAAAAGAATAAATCTAATAAAGAGAATTTCATCC
CTTTTATCTCTATGATATATAATACAAGGGTGAATTACTTTAAGTTAAACTTATTTATGA
CAAGCAGTGTTTAGAAGGCTTTATCCATTAAGATATTAAATTTATCTTCCATAACTAAAT
TGTAAAATTAATTAAAATTAATTGAATATTTTTACTAAATATTTTTTTAAAAGAATTTAA
GCAATGAAGAATTAAACGAAATTAGAAAAATTAACCAATAAGCTCATTTAAAGTTATTAA
ATCTTGATAAAATGAATCTTGAGCCTAAAAAAATTTACACTAGCAAATGTTTAATTTATA
AAAAAACATAAATCTTAGATTATAAAAACACAGAAGAAAGTGTGCTAATTAATGAAAATG
TGGTTTTTCTTTACATAATGAGTGATCTGAATTAAAATTAGATCAAAGAAATTAAATAAA
TAAATAACCACATTGATTAAATTAGAGATTTTCTTAAACTTAAAATTATTTCTGAAAAAA
TATCAAAAAAACTTAACTAAGAAATAATTGATTTTTAGAATATGCAAATAGAACAATTAA
ATGTTTTTATCAAGCCAAATTTTAAGCTTACTGGTTCGCTCTCTAAATCAAATATTAAAC
AAGATTAGAAAGAAATTTATCCTCTTTAATTTGAGAATCTGTTAACCTTAACAGAAAGAG
ATTTAATCTAAATTTTTTAGAAAAAATAATTAGAGAAAAACCTTGTGTTTTTAGGAAAGT
AATATTTCAGATTTATAACCAGCATTAATGTTTTCAATGAAAACTTTAAAACACACTATG
ATATTTTAATAAGTGAACTAGATATGAGATTTAATGATTGCTTTGTTATGTCTAAAGCAG
TAGAGTCTAAGTTTTTTAAGTACTTGCTGATCAAAGACTATGTAACTTTGGCTCCTTGCT
TGAGTATAATTTCATAGAAATTACATACGTTTGTTGCTGATCAGTTAACATTACAAGAAA
AAATTCTTATCAAAAATCATTAATAAAATCCATTAAATTATAACATGGCAGAAATTAGAA
ACAAATAATTTACAGAAATAATTTATTATATAATAGGAATTACCATAAATCAAAACCAAA
ACATTTTCAAAAACTTTGAAAAATATAGCTCATTATTTTAACCTCTTCTTAAATCATTTA
ACTTGATTGAAAAGTATAGTGTTTTAACCAAATTCGTAAATATCTAACCAGAATAGATTT
AGTATAAACCTGATAAATAAAATTTATTAAATTAATTTAGCTAGAATTCTATCAATTACA
AATTTAATAACATAGGTCTTCTCTAATAGGTATTTACTCATTCTTCATATAAATAAGATA
TGGTTTGTTCAGATCTTAATAAGATCTTTGGAACTCTAGAAAAATCTTTGAATGACTTCA
TCACCGAAATATAAAAAACAGAAAAAAGATAATCTTTTATACAGCTAAATGATGTTTCAA
ATGATGTACTTTCATTTTTAGGATCTATAATATTCTCTCAAATAGTCTTAAAGCGACTTT
ACACGAGATACAGTCAATCCAATCCAAGTATTTATTTATCTATTTCATTTCTTTGATTGA
TTAGATTTCTATTTTAAAAATTTATTATTTTGAGATGAATTCAGAAAATTGTTTTTATAT
CCAATGAGTGATTCTGATTTTTTATATAAATAAATAAATTTAGATGAATTAGATATTTTC
ATGGAAATAATATGTTGTGAATAAACAAAGTCTTTCTTGTCTGCAAAATTTAAATTAGAT
TAATACTTCATTTATGGGATTCAATATTAATAAATATTTTAAAAAATAAATCATGCAGCT
AATTTTTTGAGATAGTAAAACATTTAGAGTTTCAGAAATATTGCAACTAACTATAATAAG
GATATAAGTATTTTATCTTAACTCTTTGACTCTTTGGTAGGAGCTATATATATAGACTTA
CAATAAGATTTTGAAAAAACATCAGATTTCTTTAATTAAAATTAACACATATAATTAATT
ATAAAAGATATTTGCCAAATAGCAGATTAGTATCCTAAATATTCTTTAATTAAAGTTTTA
AAATAAAAGGGATATGATTGGGAAGATATTCAAATTATTAAATTACCACATCCAGAGTAG
TTCTTACCAATTAATTAGAATAAATATAACTTCTAGATTTATGATATTAAAAATGAAAAA
TTACTTATTGATAAGGTTTTTGAATGCCAAAGAATCGAAGAGGCATATTTGGCTATCAAA
GAATAAATCATTAACAACCCAATAAATTAATAGTCTTTATGA