Identifiers and Description

Gene Model Identifier

TTHERM_00825680

Standard Name

DCP2 (mRNA-decapping enzyme DCP2)

Aliases

PreTt04032 | 142.m00129 | 3683.m00062

Description

Catalytic subunit of the Dcp1p-Dcp2p decapping enzyme complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00825680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18253.13.000805390066315e-169hydrolase, NUDIX family protei
n (834 aa)
DictyBaseDDB_G02833155.999207186122604e-25dcp2 on chromosome: 4 position
515744 to 517800
SGDYNL118C1.0004572433669413e-23DCP2 Catalytic subunit of the
Dcp1p-Dcp2p decapping enzyme c
omplex, which removes the 5 ca
p structure from mRNAs prior t
o their degradation; member of
the Nudix hydrolase family
WormBaseWBGene000035824.001630327199692e-20locus:dcap-2 mRNA-decapping
enzyme 2 status:Partially_co
nfirmed UniProt:O62255 pro
tein_id:CAB05204.2
OxytrichaContig2671.0.g325.0013199114200274e-20Dcp2, box A domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00825680(coding)
ATGAGTTCTTATAATATCCCTAATTATATAATTTAAGACCTTTTATGTAGATTTATTATT
AATGTTCCCGAATGCGAAAGATAACTTTAAAGAATAGCCTTTAAATTGCAAGATGCTTTC
TGGCATTATATAGATTTTTATGCTAAGAAAAAGGAGATTTTATAAATTAATAATAATAGA
ATATTGACTCATGATGACTTTGATGAGTTTATAGATATTATAAAAGTTGCTACTCCTTTT
TTAAGACATATTCCAGATACTGGAAAAGATATCAAAAAAGAGTTTTATGAATATAAAAAG
AAAATTCCAAGATATGGTTGTATCATCATTAATTAAGATAGGACTAAGCTATTACTTATT
AAGAATGCTTTCTCTAAAAAGTATAGCTTTCCTAAAGGTTAGATAAATTATAATGAAACT
CCATTAGATTGTGCTATTAGAGAGACAGTTGAAGAAATAGGATTTAACGTAGCTAAATAC
ATTATACCAGATGTATGCTTACTGCATGAGTAAAGATAAAATACTCATTGCTACTACATA
GCAGATAAAGTAAACGAAAATGAAATTTTTAAAGCAATCGCTAGAAACGAAATAGAGGAT
ATCAAATGGGTGGAGGTAAGTGCAATTAGATCAAAGAAAAATATTAAGGAATTCTCAAAC
ATAGTTGAGCTGATAGATTCCATACAAGTGGTAATCAACCGTAAAGAGGAAGATGAGCTA
AAAAAGCAGTAAAAGAAAAATTAAATAGACTTCGAGTAAAAACTTAAATAGATATCAAAC
TAATTCATCGAATTTTGCTAAGATGAGTATATGATGCTGACTGAAGAGCATATTTTCCAG
AACGTCTCTAACTCAAGCGATTCTAATCCATTCTTGAATTTTAAATTTGATTAATCAAGA
TTTACTCATAATTAATGA


>TTHERM_00825680(protein)
MSSYNIPNYIIQDLLCRFIINVPECERQLQRIAFKLQDAFWHYIDFYAKKKEILQINNNR
ILTHDDFDEFIDIIKVATPFLRHIPDTGKDIKKEFYEYKKKIPRYGCIIINQDRTKLLLI
KNAFSKKYSFPKGQINYNETPLDCAIRETVEEIGFNVAKYIIPDVCLLHEQRQNTHCYYI
ADKVNENEIFKAIARNEIEDIKWVEVSAIRSKKNIKEFSNIVELIDSIQVVINRKEEDEL
KKQQKKNQIDFEQKLKQISNQFIEFCQDEYMMLTEEHIFQNVSNSSDSNPFLNFKFDQSR
FTHNQ


>TTHERM_00825680(gene)
ATGAGTTCTTATAATATCCCTAATTATATAATTTAAGACCTTTTATGGTAAATATATTAT
GACCTCATTTTTATTTAAAAATGCTAAAAATTTAAGAAATAAATTTAAAAATAAAGTAGA
TTTATTATTAATGTTCCCGAATGCGAAAGATAACTTTAAAGAATAGCCTTTAAATTGCAA
GTCCGTTTTGCTTATGAAGCATCATCAATCACTCTAAATCTTTTATTTTAAATAATAATA
GGATGCTTTCTGGCATTATATAGATTTTTATGCTAAGAAAAAGGAGATTTTATAAATTAA
TAATAATAGAATATTGACTCATGATGACTTTGATGAGTTTATAGATATTATAAAAGTTGC
TACTCCTTTTTTAAGACATATTCCAGATACTGGAAAAGATATCAAAAAAGAGTTTTATGA
ATATAAAAAGAAAATTCCAAGATATGGTTGTATCATCATTAATTAAGATAGGACTAAGCT
ATTACTTAGTACATTATTTATATTATTAAAAACTATTTTTCCAACATCTTACTAAAATAT
TTATCTTAGTTAAGAATGCTTTCTCTAAAAAGTATAGCTTTCCTAAAGGTTAGATAAATT
ATAATGAAACTCCATTAGATTGTGCTATTAGAGAGACAGTTGAAGAAATAGGATTTAACG
TAGCTAAATACATTATACCAGATGTAAAATTGTTTCATATTTTATTTATTTATGAGGCAT
ATTTTCATTTCCTTTGAATACTTAATATATCTACAAAAACCTAAGCAAATTTAAAATGTT
TTTGTGAAAGGAGGATATTTTAAATGCCATCACTTGGTTACTTGAATCATAAAATATTGA
TTTATATATAGGTATGCTTACTGCATGAGTAAAGATAAAATACTCATTGCTACTACATAG
CAGATAAAGTAAACGAAAATGAAATTTTTAAAGCAATCGCTAGAAACGAAATAGAGGATA
TCAAGTAATGATTGATAAATCTTAGGTTATATTTTATTAATAAATAAATATTCATTTTTT
AGATGGGTGGAGGTAAGTGCAATTAGATCAAAGAAAAATATTAAGGAATTCTCAAACATA
GTTGAGCTGATAGATTCCATACAAGTGGTAATCAACCGTAAAGAGGAAGATGAGCTAAAA
AAGCAGTAAAAGAAAAATTAAATAGACTTCGAGTAAAAACTTAAATAGATATCAAACTAA
TTCATCGAATTTTGCTAAGATGAGTATATGATGCTGACTGAAGAGCATATTTTCCAGAAC
GTCTCTAACTCAAGCGATTCTAATCCATTCTTGAATTTTAAATTTGATTAATCAAGATTT
ACTCATAATTAATGA