Identifiers and Description

Gene Model Identifier

TTHERM_00284230

Standard Name

DCL1 (DiCer-Like 1)

Aliases

PreTt04959 | 25.m00423 | 3694.m00206

Description

Dicer-related RNase III protein; one of three Dicer-like proteins described in T. thermophila; required for processing micronuclear transcripts into scnRNAs, methylation of histone H3 on IESs, and segregation of micronuclear chromosomes

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00636 ) RNase3 domain
  • ( TIGR01612 ) rhoptry protein
  • ( TIGR02191 ) ribonuclease III
  • ( PF00035 ) Double-stranded RNA binding motif
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( TIGR00013 ) 4-oxalocrotonate tautomerase family enzyme
  • ( PF03011 ) Plasmodium falciparum erythrocyte membrane protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.3%

TetraMine Data

TTHERM_00284230

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD01814 ) Micronucleus: homozygous neo3 KO of DCL1, Macronucleus: homozygous ΔDCL1, neo 3 was deleted in mac and assorted to pm-s; MTT1-DCL1 replaced some of MTT1
  • ( SD01815 ) Micronucleus: homozygous neo3 KO of DCL1, Macronucleus: homozygous ΔDCL1, neo 3 was deleted in mac and assorted to pm-s; MTT1-DCL1 replaced some of MTT1
  • ( SD01925 ) Micronucleus: homozygous neo3 KO of DCL1, Macronucleus: homozygous ΔDCL1 ,neo 3 was deleted in mac and assorted to pm-s;
  • ( SD01926 ) Micronucleus: homozygous neo3 KO of DCL1, Macronucleus: homozygous ΔDCL1 ,neo 3 was deleted in mac and assorted to pm-s
  • ( SD01927 ) Micronucleus: homozygous neo3 KO of DCL1, Macronucleus: ΔDCL1 ,neo 3 was deleted in mac and assorted to pm-s
  • ( SD02277 ) Micronucleus: homozygous neo3 KO of DCL1, Macronucleus: ΔDCL1 ,neo 3 was deleted in mac and assorted to pm-s
  • ( SD02278 ) Micronucleus: homozygous neo3 KO of DCL1, Macronucleus: homozygous ΔDCL1 ,neo 3 was deleted in mac and assorted to pm-s; MTT1-DCL1 replaced some of MTT1
  • ( SD02279 ) Micronucleus: homozygous neo3 KO of DCL1, Macronucleus: homozygous ΔDCL1 ,neo 3 was deleted in mac and assorted to pm-s; MTT1-DCL1 replaced some of MTT1
  • ( SD02832 ) Macronucleus: Mac-DCL1 was completely replaced with DCL1-HA- with neo3 in 3’ flanking region
  • ( SD02835 ) Micronucleus: heterozygous neo3 KO of DCL1,
  • ( SD02836 ) Micronucleus: heterozygous neo3 KO of DCL1
  • ( SD02589 ) Micronucleus: Neo 3 into DCL1 and HA tagged TWI11 into the TWI11 locus
  • ( SD02590 ) Micronucleus: Neo 3 into DCL1 and HA tagged TWI11 into the TWI11 locus
  • ( SD02591 ) Micronucleus: HA tagged TWI 11 Macronucleus: Neo3 KO of DCL1
  • ( SD02592 ) Micronucleus: HA tagged TWI 11, heterozygous with WT Macronucleus: Neo3 KO of DCL1 complete somatic

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09053.19.997093137033517e-262dicer-like RNase III protein D
cr1p (1208 aa)
OxytrichaContig15171.0.g967.997402223525235e-19Ribonuclease III domain
WormBaseWBGene000009390.00000000039982266684865623locus:dcr-1 Endoribonuclease
dcr-1 status:Partially_conf
irmed UniProt:P34529 prote
in_id:CCD71200.2

General Information

Paragraph NoGene NameParagraph Text
2TWI1,
HHT2,
PDD1,
PDD3,
DCL1
A proposed model for the mechanism of programmed DNA elimination in Tetrahymena is based on the timing of expression, cellular distribution, mutant phenotypes, and predicted functions of the protein and RNA components involved. In this model, both strands of the micronuclear genome (or perhaps only the portions containing internal eliminated sequences) are transcribed early in conjugation to produce large non-genic, double-stranded RNAs. This transcription is likely performed by RNA Polymerase II, based on the localization of its subunit Rpb3p to the micronucleus during this time. These transcripts pass to the cytoplasm where they are processed into short (~28 nucleotide) scan RNAs (scnRNA) by the dicer-like protein Dcl1p, similar to the production of the small inhibitory RNAs (siRNA) central to the RNA interference (RNAi) pathway of other eukaryotes. The scnRNAs complex with Twi1p, a member of the PPD (PAZ and Piwi Domain) protein family, whose members are commonly involved in RNAi and related processes. The scnRNA/Twi1p complexes enter the old macronucleus, where scnRNAs homologous to DNA sequences found there are degraded. The remaining scnRNAs, comprised of micronuclear-restricted sequences, are transferred to the developing macronucleus. There, histone H3 proteins (Hht1p, Hht2p) that are bound to sections of the genome sharing identity to the scnRNAs are methylated on lysine-9. This modification, which is often associated with the formation of heterochromatin, is recognized by one or more of the chromodomains belonging to Pdd1p and Pdd3p. Regions of DNA associated with these modified histones are eliminated from the developing macronuclear genome.

Associated Literature

  1. Ref:29021213: Noto T, Mochizuki K (2017) Whats, hows and whys of programmed DNA elimination in Tetrahymena. Open biology 7(10):
  2. Ref:26769902: Woo TT, Chao JL, Yao MC (2016) Dynamic distributions of long double-stranded RNA in Tetrahymena during nuclear development and genome rearrangements. Journal of cell science 129(5):1046-58
  3. Ref:16199890: Malone CD, Anderson AM, Motl JA, Rexer CH, Chalker DL (2005) Germ line transcripts are processed by a Dicer-like protein that is essential for developmentally programmed genome rearrangements of Tetrahymena thermophila. Molecular and cellular biology 25(20):9151-64
  4. Ref:15598983: Mochizuki K, Gorovsky MA (2005) A Dicer-like protein in Tetrahymena has distinct functions in genome rearrangement, chromosome segregation, and meiotic prophase. Genes & development 19(1):77-89

Sequences

>TTHERM_00284230(coding)
ATGAGAAACAAACCTAAAGTTAAAAGTGCTAAGTTGGGCTTTAAAATCATTTGCCATTCC
ATTAAAAAATAGTACTCATCAATTAAAAAAACTAAACAAAAAAAAATAGATAAAGGATAA
TCAAAAAAAAGATTGACAGCTATTAAATAAAAGCAAGGTTATGATATAAAAATGGACATG
CAACTAAGTTAAATACCAGAAGCAGAGAATTTAGCTTTTCAGTTTGATGCTAAGAATTAA
TGTCAAAAAACAGTAGATTACTTGTTGAGTTAAAATCTAGAATAAATATCCTAGTGCACT
TATATCTAGCAACCATTTAGAGAAATTAAATAAAAGAAAGATACACACAATGAAAGTGAT
GAAGAAAGCAAAATTTATGAGGTCTATTTACATTAAGTGTATAATACTGAAAACCCTGCT
TACGTTTTTGGATTCATTTCAAGTGTAAAATTACCAGAGTTAAGAGAATTAGAACTATTT
TTAAGAAAAGATCTTGAAGATTATAAATCTGAAGTTAATCCTTGCATTTATTAGCTGAAG
TTTATTTCTACTATAAGCCTATCATCCTCAGAGCTTTTGTCAATTTATAACTTCAATACT
GGATTTTTTAAGGATTTTTAGTAGGAAGGAAACTAAATTTCAAGCTACATCTTTGAGTAT
TTCATGTAGTCTACAATTTCTGTGAAATTTCTTTAAGTTCTACTAACTCAAAAATACATA
GAAGTAGAATTAAATAATTTCAATAATAATCATGTCTTAACAAATTTTGATAGTAAAAAA
TGTGATATGGAAAAAGAGATAAATGAGAACCCATATTAATTCATAGATTTTGACTTAATA
CATAACTTTAATCTTTAGAAAAAACAGAAAAGTATTCTAGATAATAAATTAAATTTAGCA
ACAACATTTATAAATTTTAGTTAAGATTTGCAAATGATTGATGAAACATCAAAATCAGAT
AATTTGGACAAATAAAATGTAACAATAATTGAATTAATTAATGAAAATACTTTAACGATG
AATCAAAAAGATTAATTAATTGAAAATGAAAATAAATTATAAGATGAAGTAATAATTTTA
CCAACCAAATAAATTGAAGAATTTAATTTGACTTTTTAAAAGGAAAAAAATAAAATAAAT
GATATTTCTGATCAAGAAATCACTTAAAATCTTCATGATCTAAAAAAAATTGATGTTGAT
TCAAATAATTAACAAGAAAATACTTGTAGTTCAGTAGTAGTAACTGAATAAAATGGGCAA
AAGCAAGAATTGGTAAATGATTAAAATAAACAACTTTAAGAAATCTAACAAAGTGAATAA
GATTAAATTCCTGAAAATTAAATGAAAATGTAAGATCCCACCAATTAAGATTAATAATAA
AAACCAAGAGTTAAATTAGATGGAGATTTATTTTAAGAAAGTGAAAAACTTAATAATATT
TCACTTACTTTGAAAAATGAAAAATTTAGATTGGCTTACTAATCTAATATTTATCGCCAT
TTGTTCTTAAATTAAGATCTTTATCAAATAGTTGAGATTTTTGATCCATCAAATACTACT
ATTGATCAGTTTATATAGTCATTATCGTAACATACAGGTATGAGCTATGACAGTATCAAA
TAGAAACTCTTTCTAAAGTAAGACGCTACATAAAAAGACTTGCAAAGTGATACTCTTTAT
GACTGTATATATAGCTAACCAGATAAATACCTTACTGACAAAGCATAAATGTTTTTTGCA
ATTAGAAAATAATTTGTAAATTTTTAAAAAAAAGAAATTTAATAATACATATAAGATTAT
TAGCAACAATTGATAGCAAATAATAATATTTAAACTAATCAATAAACTTAGAATAAATAT
AATTAGAATACAAATTAAATTTCCCAATACCATCAATTTAATCGCCGTAATCCATTAGTA
CTTTGTAGAAAGATTAATCATTTGAAAAATTTCGATTTCCTTAGTGATGCTCATATTAAA
AATAACAAGGGAGTTTTCCAGTCTTGCTTACAAAAAGACTTTTCTGATAACAAGATTAAC
ATGTCGCTTTTACCTTTAGAGCATTTTGAATAACATGTTTTAAATACTTAGTTGATTAAC
TCTCACTTATAAGCTCCTTCTATCTTTGCCTTAATTAAAGATGTCATGATTGTTAGAGAT
TTTGCTTGTAACTACTTTTTAGAAAATAATGTAGATTTAGAATTACTTATTGAGTCATTT
TCGTAGATCTCTTACAGTAAAACTAAAAACCTAGAATTGCTTGAGGTAATAGGTGATGTT
GTAATCAAATACATCTCTTCTCTTTATCTTTATTTGCATCTTCCAAATTAAAGCGAAAAT
GCCCTTACAATGATACGCACTATTTTTATTAACAACAAATATTTAGGAATTTCAGCGTTT
AGAAACGGTCTCTAATTTTATGTTCAGACTAAAAGACCAAGTTCTTATGACTGGAGATTT
AATTTATTCAATTTGAATTCTTTCACTGAAGCACCGCAAGATTAAAAATAATCTTTTTAG
CTATCTTACTCAAATTTATCTGATACCCTTGAATCAGTTGTTGGGTGCTTTTATGCCAGC
AATTAATTTACTTTGAATACATGTATTTAGCTAATCAAAGATTTAGGACTCTAGATAGAT
TAATATCTCCTAAATAAGTTTTAGAATTAGGTCAATGGGAGCTTCGTTTTGAGTGATGAT
ATTATCGATTTGATGGAGATAGATGAGGAAATGACTTACTATGAACTTTAATTATAAGGA
AAGAAATTTTTATAAAAAGAATTTGAAATTTAGGCAAATAAAAAAATGGAATAGTGCTTT
GAAGAAAAGATTTAGAATGAAATAATTCAAAATGAAGAAAATACACAATTTATATGGAAT
CTTATTAAGTTTTATATTAAAGATGAATTATTTTATAAAAATAAGTATGAAGTAGAATTT
TAAAATAATACTTGTCCTAATCAGAGAAGGAAGGACAGGTCTGAATATAGAAAATTTAAA
TAGCTTCATGAGTAAACACTGGACATAGCCATAAGTGGCTTTGAAAAAATACTGAACTAC
ACTTTTAAAGACAAATCTTTATTAATAAAAGCATTAAATTGTCATTCAAACAGCAACTTT
GAGCATTACTTTTAAGATTATTAGATATTGGAATTTTTGGGAGATGCCTTAATAGAGATT
TTAGTTGTTTCTCATGGTTATCATATTTCAAGAAATAGGCAAAAAAAAATAAATTCTCCT
TACTTCTTTTGCGAAATGAAGTCTCTTTTGCTCAGCAATGACTTTATGTCTAGAATGGCT
ATCCTTAATAAATTTCATTATTATGCTTTGAATATAAGTAAATATTAGTAAGATGAAATT
ATCTAATTTATAGAGGATTGCAACCTAAATACTAAGTTTAAAGAGTCAGTGTCGCATCAA
GCTAATTCTCCCAAAGTTCTAGGTGATTTATGGGAGTCAGTTGCTGGAGCAATCATAATG
GATTCTGATATTTCAACTTTTGTTTCAATTTATGGAAAACTATATGCTCCATACATTATT
CATTTCGTTACATTTTACTAAAAAATTATTTTTAATGTGAAAGAGAAAGTTTAATTAGTT
GCCTAGTAAACTTATGAATAATTAGGAAAAATTACAGAGGTAGTCAAAGACACTGATGGA
TAATATAAAGTCAAAGTTACGATTCTAATTAAATAAATCAAAGTAGGAACAGGAATAGAT
TATTCTGAAACTTTAGCTGAAAAAAAAGCCTTCTAAGATGCTTATGATCACATTTTCATC
AAACAATAATCAAATCTAGGATTAATATTCTAAGGAAAGTAAGTATGA


>TTHERM_00284230(protein)
MRNKPKVKSAKLGFKIICHSIKKQYSSIKKTKQKKIDKGQSKKRLTAIKQKQGYDIKMDM
QLSQIPEAENLAFQFDAKNQCQKTVDYLLSQNLEQISQCTYIQQPFREIKQKKDTHNESD
EESKIYEVYLHQVYNTENPAYVFGFISSVKLPELRELELFLRKDLEDYKSEVNPCIYQLK
FISTISLSSSELLSIYNFNTGFFKDFQQEGNQISSYIFEYFMQSTISVKFLQVLLTQKYI
EVELNNFNNNHVLTNFDSKKCDMEKEINENPYQFIDFDLIHNFNLQKKQKSILDNKLNLA
TTFINFSQDLQMIDETSKSDNLDKQNVTIIELINENTLTMNQKDQLIENENKLQDEVIIL
PTKQIEEFNLTFQKEKNKINDISDQEITQNLHDLKKIDVDSNNQQENTCSSVVVTEQNGQ
KQELVNDQNKQLQEIQQSEQDQIPENQMKMQDPTNQDQQQKPRVKLDGDLFQESEKLNNI
SLTLKNEKFRLAYQSNIYRHLFLNQDLYQIVEIFDPSNTTIDQFIQSLSQHTGMSYDSIK
QKLFLKQDATQKDLQSDTLYDCIYSQPDKYLTDKAQMFFAIRKQFVNFQKKEIQQYIQDY
QQQLIANNNIQTNQQTQNKYNQNTNQISQYHQFNRRNPLVLCRKINHLKNFDFLSDAHIK
NNKGVFQSCLQKDFSDNKINMSLLPLEHFEQHVLNTQLINSHLQAPSIFALIKDVMIVRD
FACNYFLENNVDLELLIESFSQISYSKTKNLELLEVIGDVVIKYISSLYLYLHLPNQSEN
ALTMIRTIFINNKYLGISAFRNGLQFYVQTKRPSSYDWRFNLFNLNSFTEAPQDQKQSFQ
LSYSNLSDTLESVVGCFYASNQFTLNTCIQLIKDLGLQIDQYLLNKFQNQVNGSFVLSDD
IIDLMEIDEEMTYYELQLQGKKFLQKEFEIQANKKMEQCFEEKIQNEIIQNEENTQFIWN
LIKFYIKDELFYKNKYEVEFQNNTCPNQRRKDRSEYRKFKQLHEQTLDIAISGFEKILNY
TFKDKSLLIKALNCHSNSNFEHYFQDYQILEFLGDALIEILVVSHGYHISRNRQKKINSP
YFFCEMKSLLLSNDFMSRMAILNKFHYYALNISKYQQDEIIQFIEDCNLNTKFKESVSHQ
ANSPKVLGDLWESVAGAIIMDSDISTFVSIYGKLYAPYIIHFVTFYQKIIFNVKEKVQLV
AQQTYEQLGKITEVVKDTDGQYKVKVTILIKQIKVGTGIDYSETLAEKKAFQDAYDHIFI
KQQSNLGLIFQGKQV


>TTHERM_00284230(gene)
ATGAGAAACAAACCTAAAGTTAAAAGTGCTAAGTTGGGCTTTAAAATCATTTGCCATTCC
ATTAAAAAATAGTACTCATCAATTAAAAAAACTAAACAAAAAAAAATAGATAAAGGATAA
TCAAAAAAAAGATTGACAGCTATTAAATAAAAGCAAGGTTATGATATAAAAATGGACATG
CAACTAAGTTAAATACCAGAAGCAGAGAATTTAGCTTTTCAGTTTGATGCTAAGAATTAA
TGTCAAAAAACAGTAGATTACTTGTTGAGTTAAAATCTAGAATAAATATCCTAGTGCACT
TATATCTAGCAACCATTTAGAGAAATTAAATAAAAGAAAGATACACACAATGAAAGTGAT
GAAGAAAGCAAAATTTATGAGGTCTATTTACATTAAGTGTATAATACTGAAAACCCTGCT
TACGTTTTTGGATTCATTTCAAGTGTAAAATTACCAGAGTTAAGAGAATTAGAACTATTT
TTAAGAAAAGATCTTGAAGATTATAAATCTGAAGTTAATCCTTGCATTTATTAGCTGAAG
TTTATTTCTACTATAAGCCTATCATCCTCAGAGCTTTTGTCAATTTATAACTTCAATACT
GGATTTTTTAAGGATTTTTAGTAGGAAGGAAACTAAATTTCAAGCTACATCTTTGAGTAT
TTCATGTAGTCTACAATTTCTGTGAAATTTCTTTAAGTTCTACTAACTCAAAAATACATA
GAAGTAGAATTAAATAATTTCAATAATAATCATGTCTTAACAAATTTTGATAGTAAAAAA
TGTGATATGGAAAAAGAGATAAATGAGAACCCATATTAATTCATAGATTTTGACTTAATA
CATAACTTTAATCTTTAGAAAAAACAGAAAAGTATTCTAGATAATAAATTAAATTTAGCA
ACAACATTTATAAATTTTAGTTAAGATTTGCAAATGATTGATGAAACATCAAAATCAGAT
AATTTGGACAAATAAAATGTAACAATAATTGAATTAATTAATGAAAATACTTTAACGATG
AATCAAAAAGATTAATTAATTGAAAATGAAAATAAATTATAAGATGAAGTAATAATTTTA
CCAACCAAATAAATTGAAGAATTTAATTTGACTTTTTAAAAGGAAAAAAATAAAATAAAT
GATATTTCTGATCAAGAAATCACTTAAAATCTTCATGATCTAAAAAAAATTGATGTTGAT
TCAAATAATTAACAAGAAAATACTTGTAGTTCAGTAGTAGTAACTGAATAAAATGGGCAA
AAGCAAGAATTGGTAAATGATTAAAATAAACAACTTTAAGAAATCTAACAAAGTGAATAA
GATTAAATTCCTGAAAATTAAATGAAAATGTAAGATCCCACCAATTAAGATTAATAATAA
AAACCAAGAGTTAAATTAGATGGAGATTTATTTTAAGAAAGTGAAAAACTTAATAATATT
TCACTTACTTTGAAAAATGAAAAATTTAGATTGGCTTACTAATCTAATATTTATCGCCAT
TTGTTCTTAAATTAAGATCTTTATCAAATAGTTGAGATTTTTGATCCATCAAATACTACT
ATTGATCAGTTTATATAGTCATTATCGTAACATACAGGTATGAGCTATGACAGTATCAAA
TAGAAACTCTTTCTAAAGTAAGACGCTACATAAAAAGACTTGCAAAGTGATACTCTTTAT
GACTGTATATATAGCTAACCAGATAAATACCTTACTGACAAAGCATAAATGTTTTTTGCA
ATTAGAAAATAATTTGTAAATTTTTAAAAAAAAGAAATTTAATAATACATATAAGATTAT
TAGCAACAATTGATAGCAAATAATAATATTTAAACTAATCAATAAACTTAGAATAAATAT
AATTAGAATACAAATTAAATTTCCCAATACCATCAATTTAATCGCCGTAATCCATTAGTA
CTTTGTAGAAAGATTAATCATTTGAAAAATTTCGATTTCCTTAGTGATGCTCATATTAAA
AATAACAAGGGAGTTTTCCAGTCTTGCTTACAAAAAGACTTTTCTGATAACAAGATTAAC
ATGTCGCTTTTACCTTTAGAGCATTTTGAATAACATGTTTTAAATACTTAGTTGATTAAC
TCTCACTTATAAGCTCCTTCTATCTTTGCCTTAATTAAAGATGTCATGATTGTTAGAGAT
TTTGCTTGTAACTACTTTTTAGAAAATAATGTAGATTTAGAATTACTTATTGAGTCATTT
TCGTAGATCTCTTACAGTAAAACTAAAAACCTAGAATTGCTTGAGGTAATAGGTGATGTT
GTAATCAAATACATCTCTTCTCTTTATCTTTATTTGCATCTTCCAAATTAAAGCGAAAAT
GCCCTTACAATGATACGCACTATTTTTATTAACAACAAATATTTAGGAATTTCAGCGTTT
AGAAACGGTCTCTAATTTTATGTTCAGACTAAAAGACCAAGTTCTTATGACTGGAGATTT
AATTTATTCAATTTGAATTCTTTCACTGAAGCACCGCAAGATTAAAAGTAAATTATTTTA
TTTTTCAACAAATTTTATACTAAAATAATTTTTTGAATTTAGATAATCTTTTTAGCTATC
TTACTCAAATTTATCTGATACCCTTGAATCAGTTGTTGGGTGCTTTTATGCCAGCAATTA
ATTTACTTTGAATACATGTATTTAGCTAATCAAAGATTTAGGACTCTAGATAGATTAATA
TCTCCTAAATAAGTTTTAGAATTAGGTCAATGGGAGCTTCGTTTTGAGTGATGATATTAT
CGATTTGATGGAGATAGATGAGGAAATGACTTACTATGAACTTTAATTATAAGGAAAGAA
ATTTTTATAAAAAGAATTTGAAATTTAGGCAAATAAAAAAATGGAATAGTGCTTTGAAGA
AAAGATTTAGAATGAAATAATTCAAAATGAAGAAAATACACAATTTATATGGAATCTTAT
TAAGTTTTATATTAAAGATGAATTATTTTATAAAAATAAGTATGAAGTAGAATTTTAAAA
TAATACTTGTCCTAATCAGAGAAGGAAGGACAGGTCTGAATATAGAAAATTTAAATAGCT
TCATGAGTAAACACTGGACATAGCCATAAGTGGCTTTGAAAAAATACTGAACTACACTTT
TAAAGACAAATCTTTATTAATAAAAGCATTAAATTGTCATTCAAACAGCAACTTTGAGCA
TTACTTTTAAGATTATTAGATATTGGAATTTTTGGGAGATGCCTTAATAGAGATTTTAGT
TGTTTCTCATGGTTATCATATTTCAAGAAATAGGCAAAAAAAAATAAATTCTCCTTACTT
CTTTTGCGAAATGAAGTCTCTTTTGCTCAGCAATGACTTTATGTCTAGAATGGCTATCCT
TAATAAATTTCATTATTATGCTTTGAATATAAGTAAATATTAGTAAGATGAAATTATCTA
ATTTATAGAGGATTGCAACCTAAATACTAAGTTTAAAGAGTCAGTGTCGCATCAAGCTAA
TTCTCCCAAAGTTCTAGGTGATTTATGGGAGTCAGTTGCTGGAGCAATCATAATGGATTC
TGATATTTCAACTTTTGTTTCAATTTATGGAAAACTATATGCTCCATACATTATTCATTT
CGTTACATTTTACTAAAAAATTATTTTTAATGTGAAAGAGAAAGTTTAATTAGTTGCCTA
GTAAACTTATGAATAATTAGGAAAAATTACAGAGGTAGTCAAAGACACTGATGGATAATA
TAAAGTCAAAGTTACGATTCTAATTAAATAAATCAAAGTAGGAACAGGAATAGATTATTC
TGAAACTTTAGCTGAAAAAAAAGCCTTCTAAGATGCTTATGATCACATTTTCATCAAACA
ATAATCAAATCTAGGATTAATATTCTAAGGAAAGTAAGTATGA