Identifiers and Description

Gene Model Identifier

TTHERM_00498180

Standard Name

DCD1 (DeoxyCytidylate Deaminase)

Aliases

PreTt06983 | 62.m00267 | 3715.m00128

Description

Cytidine and deoxycytidylate deaminase zinc-binding region family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( TIGR00152 ) dephospho-CoA kinase
  • ( TIGR02571 ) ComE operon protein 2
  • ( PF00383 ) Cytidine and deoxycytidylate deaminase zinc-binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 16.7%

TetraMine Data

TTHERM_00498180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12657.15.998685392774004e-165cytidine and deoxycytidylate d
eaminase zinc-binding region f
amily protein (359 aa)
OxytrichaContig6385.0.g211.0004249259458435e-52Cytidine and deoxycytidylate d
eaminase zinc-binding region
SGDYHR144C9.99893167504554e-35DCD1 Deoxycytidine monophospha
te (dCMP) deaminase required f
or dCTP and dTTP synthesis; ex
pression is NOT cell cycle reg
ulated
Stentor CoeruleusSteCoe_273732.8625185805493937e-20
WormBaseWBGene000140340.0000000000002999981760818895Probable deoxycytidylate deami
nase status:Confirmed UniP
rot:P30648 protein_id:CAA774
73.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00498180(coding)
ATGGCTGAGAAAAATAACAAGAAATAATTCTAAATTATAATTGGCTTAGTAGGAAAGATC
TGCTCTGGAAAAACAACCTTTTGTGAATTGATTACTAAGAGAGGTCTTAGATGCATAAAA
GGAGATGATATTCCCTTGGAGAACCTAATCTAACTTATTGTTAAACTTAGAAAATAAGGA
GCAACATAATAGGAATTGAAATAAATTTTAATGGAAGAAATAAATACCATTAAAGCAAAT
CTTAAAAATTAATATGAAAAAAGATGCAAAAAACTGTTAGAAGAATGGACATTACCTACA
ATAATTAGTAGAATTTACACGAATAATGAAGTTTAATTTTTATCAAAAAGAAATTTCTTC
CATAAAATATACTTGGACTGTCCTTTACTAACACGCTTTGAAAACTTCAAAAATAAATAT
AACAAATATTCAGGTGATATAGACCTAAATATGTTTTGCCTTTTAGATGATTGCGTTAAT
TATGGGTTGAATATTTAAGGTATCATTCAAGAATTTAAAGTAACAGTAAGTAATGAAGGA
AGTGTAGATGATTTAGATAATTACATTTCAAAAAATGAAAAAAAAATACTGAGAGAATAT
AAGCCAAGCTGGGATGAATATTTCATGAGGTTAGCAGTAGAGGTAAAAAAAAGAAGCAAC
TGCAATAAAAGAAGTGTAGGAGCTATTTTGATTTCTAAAGAAAAAAGAATTCTTTCAACA
GGATATAATGGAACTCCATTAAGGATGAAGGATTGCTTTTACGGAGGCTGTGAAAGATGT
AATCAAAATACTGCATAAGGTTAAGGTTTAGACTAATGCTGGTGCATCCATGCTGAAGAG
AACTGCTTATTAGACATTGGTGTAAGAGAGAGCAAGTAATTTGAACCAACTATGTATACA
ACCCTCTTCCCTTGTAGAATGTGTGCAAAAGTTATAATTTAAAGTGGAGTAACTAGAATA
GTTTACATGGAAGATTTTGATAGTAATAAAAGTAAAGATATTATTGATGAATACAACAAT
TAGAATCCAAGTCATATGTTGATTCTTTAAAAATTATCTTTAGATGATTATGTTTACTGA


>TTHERM_00498180(protein)
MAEKNNKKQFQIIIGLVGKICSGKTTFCELITKRGLRCIKGDDIPLENLIQLIVKLRKQG
ATQQELKQILMEEINTIKANLKNQYEKRCKKLLEEWTLPTIISRIYTNNEVQFLSKRNFF
HKIYLDCPLLTRFENFKNKYNKYSGDIDLNMFCLLDDCVNYGLNIQGIIQEFKVTVSNEG
SVDDLDNYISKNEKKILREYKPSWDEYFMRLAVEVKKRSNCNKRSVGAILISKEKRILST
GYNGTPLRMKDCFYGGCERCNQNTAQGQGLDQCWCIHAEENCLLDIGVRESKQFEPTMYT
TLFPCRMCAKVIIQSGVTRIVYMEDFDSNKSKDIIDEYNNQNPSHMLILQKLSLDDYVY


>TTHERM_00498180(gene)
ATGGCTGAGAAAAATAACAAGAAATAATTCTAAATTATAATTGGCTTAGTAGGAAAGATC
TGCTCTGGAAAAACAACCTTTTGTGAATTGATTACTAAGAGAGGTCTTAGATGCATAAAA
GGAGATGATATTCCCTTGGAGAACCTAATCTAACTTATTGTTAAACTTAGAAAATAAGGA
GCAACATAATAGGAATTGAAATAAATTTTAATGGAAGAAATAAATACCATTAAAGCAAAT
CTTAAAAATTAATATGAAAAAAGATGCAAAAAACTGTTAGAAGAATGGACATTACCTACA
ATAATTAGTAGAATTTACACGAATAATGAAGTTTAATTTTTATCAAAAAGAAATTTCTTC
CATAAAATATACTTGGACTGTCCTTTACTAACACGCTTTGAAAACTTCAAAAATAAATAT
AACAAATATTCAGGTGATATAGACCTAAATATGTTTTGCCTTTTAGATGATTGCGTAAAC
TAGAATTTTAGCTTGACAATTTATTTATTGATTTATTTGTTTATTTTCATTAATAGAATA
TTAATTTATGCCTTAAAATATAAAGGTTAATTATGGGTTGAATATTTAAGGTATCATTCA
AGAATTTAAAGTAACAGTAAGTAATGAAGGAAGTGTAGATGATTTAGATAATTACATTTC
AAGTAATATTTGGCATTTTATCAAAAGTTTTAAAATTAATTTTATTAATAGAAAATGAAA
AAAAAATACTGAGAGAATATAAGCCAAGCTGGGATGAATATTTCATGAGGTTAGCAGTAG
AGGTAAAAAAAAGAAGCAACTGCAATAAAAGAAGGTATAAGATATTAAACATATATTAAT
TTAATTCTTCGTTTTGTATATAGTGTAGGAGCTATTTTGATTTCTAAAGAAAAAAGAATT
CTTTCAACAGGATATAATGGAACTCCATTAAGGATGAAGGATTGCTTTTACGGTATGCAT
CATTGAAAGAGATATATATTATAGTTTATCTAATTTAATATTTTATTTTTAGGAGGCTGT
GAAAGATGTAATCAAAATACTGCATAAGGTTAAGGTTTAGACTAATGCTGGTGCATCCAT
GCTGAAGAGAACTGCTTATTAGACATTGGTGTAAGAGAGAGCAAGTAATTTGAACCAACT
ATGTATACAACCCTCTTCCCTTGTAGAATGTGTGCAAAAGTTATAATTTAAAGTGTAATA
ATTATTTTTAATGAGTTTTATCTTTCAAACACTTATTTATCAATAATTAGGGAGTAACTA
GAATAGTTTACATGGAAGATTTTGATAGTAATAAAAGTAAAGATATTATTGATGAATACA
ACAATTAGAATCCAAGTCATATGTTGATTCTTTAAAAATTATCTTTAGATGATTATGTTT
ACTGA