Identifiers and Description

Gene Model Identifier

TTHERM_00294940

Standard Name

D1LIC

Aliases

PreTt15604 | 27.m00264 | 3692.m00067

Description

Light-intermediate chain subunit of non-axonemal dynein complex 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF08011 ) Protein of unknown function (DUF1703)
  • ( PF05783 ) Dynein light intermediate chain (DLIC)
  • ( TIGR00288 ) conserved hypothetical protein TIGR00288
  • ( PF09006 ) Lung surfactant protein D coiled-coil

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00294940

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08755.19.997093137033517e-262Ras family protein (459 aa)
OxytrichaContig11500.0.g389.995951036711152e-55Dynein light intermediate chai
n (DLIC)
DictyBaseDDB_G02929043.998777993244535e-41dync1li1 on chromosome: 6 posi
tion 2245112 to 2247070
WormBaseWBGene000010072.0009605191578312e-25locus:dli-1 status:Confirmed
UniProt:G5ECK7 protein_id
:CAC42262.2
Stentor CoeruleusSteCoe_56753.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00294940(coding)
ATGTCAAGCAAAGAGCCCTCAAAGAAGGAGAATTTATGGAACAACATCTTAAATGAAACA
GGATAAAAGAATAAATTTTAAAATAAGTAGGTTCTTGTATTAGGAACTAGAGGAACAGGC
AAAAGAACTTTAATAGATTCGCTACACGAAATTTCTTAAACAATTTACCCAAAAATAAGA
TCAAATGAAATGCAAAGCGGTAAACTTAGAATAGCAGGATCTGTATCTGCATTAGATTAT
GTTTATTTAAACGTCAAGAATTTAGACGATTAAGATGAAGATACTATGGCTAAATTAGGA
TTCTATATAATTGATGAAGAAACTTAAAGCCAGTTGCTGCCTATTGTATTGAAATAAAAT
ACTGTAAAGGACACATTAATAACTATTATGCTTGATCTATCAGAACCTTGGACTTTTATG
GAACAACTGGATAAATGGATAGAAATGATTACAAATCACTTACAATCTTTATAAATAAAT
CTTGAAACATTAGATTAAATGAGAGCTAAAGTGGAGAAGCTGTTTAGAGACTACAAAGAA
CCTGTTTTGGACTCTGATGGAAAATTAGTAAAATCAGATACCTAAATTTCTCCTGAAGAA
GAAGCAGAGTTAATTAAACTTAAAAGTAGTGTCCCTCTTCCAGAAGGCTCTCTTACATCT
AACTTAGGTATTCCTATAGTCATATTAGCAAATAAGTCTGATTTGATTGCTTAGAGCAAT
GATCAATAAAGCTAAATTGTCTTATATTATTTAAGAAAGTATTGCCTTTAATATGGTGCA
AGTTTAGTCTTTACCTCTAGCAAAAACTAAGAAAGCTTAGAAATTTATTATGAATATATG
CTTCATACATTATATGGTTTTAAAAACAAAAATAAGTCAGAAATATATACAATTGACTCT
ATTTTCATACCTTCTGGTTCAGATAACTTAAATCTTTTAAAGTAGAGTAACTCAACTATT
TTTGAATAATGCGACTCTAAACCTTATGAGGAACTAGTTAAAAGACCTACTAGTAAGAAT
CAAAGATAGGAGGAAGTTGTTTGCGAAGATGAACAAGAATTTTTAAAGAATTTAGTTAAT
GATAAGTCCAATCCTGAACCTATATAAAGTGCTAAATCTTCAATTTCTGCTATTCTTTAA
TCAGGCACAAGTTCGACTTCTACAAGAACAGTAAATCCTCCTATAGTAGGGAACTAAGGT
ACTACAAGTGTTGCTAAATTCTACTAGACTCTACTTAACTAGCCAAATGATGCTAGAAGA
CTCAGAGAAAATGCTGAAAGAGACTTACAACAAAGAGTTGGAAATAGTACAAATAATTAT
TTTAGAAACGACGAAATTTAGTAGGTCAAAGATATTATAAAAAAGCAAAATTGA


>TTHERM_00294940(protein)
MSSKEPSKKENLWNNILNETGQKNKFQNKQVLVLGTRGTGKRTLIDSLHEISQTIYPKIR
SNEMQSGKLRIAGSVSALDYVYLNVKNLDDQDEDTMAKLGFYIIDEETQSQLLPIVLKQN
TVKDTLITIMLDLSEPWTFMEQLDKWIEMITNHLQSLQINLETLDQMRAKVEKLFRDYKE
PVLDSDGKLVKSDTQISPEEEAELIKLKSSVPLPEGSLTSNLGIPIVILANKSDLIAQSN
DQQSQIVLYYLRKYCLQYGASLVFTSSKNQESLEIYYEYMLHTLYGFKNKNKSEIYTIDS
IFIPSGSDNLNLLKQSNSTIFEQCDSKPYEELVKRPTSKNQRQEEVVCEDEQEFLKNLVN
DKSNPEPIQSAKSSISAILQSGTSSTSTRTVNPPIVGNQGTTSVAKFYQTLLNQPNDARR
LRENAERDLQQRVGNSTNNYFRNDEIQQVKDIIKKQN


>TTHERM_00294940(gene)
ATGTCAAGCAAAGAGCCCTCAAAGAAGGAGAATTTATGGAACAACATCTTAAATGAAACA
GGATAAAAGAATAAATTTTAAAATAAGTAGGTTCTTGTATTAGGAACTAGAGGAACAGGC
AAAAGAACTTTAATAGATTCGCTACACGAAATTTCTTAAACAATTTACCCAAAAATAAGT
AATGATGCTAACATTTTTTTATTTGAAAGTTACTTAATATCTCAAAAAGAACAACTTGAT
GAGCATTTAATCTATGATTAATTAACATTATAAAAAAGGCAATAAATTTAATTAATTAAA
TATGTTTATTTAGGATCAAATGAAATGCAAAGCGGTAAACTTAGAATAGCAGGATCTGTA
TCTGCATTAGATTATGTTTATTTAAACGTCAAGAATTTAGACGATTAAGATGAAGGTATA
TATTAAATAGTATAATTGCAATATCAAAGAACTATTTTCTAATATAATATTTAGATACTA
TGGCTAAATTAGGATTCTATATAATTGATGAAGAAACTTAAAGGTAATTGCAATTCATCA
TTTTTATTTTCTCCAAATAAATTTTTGCGCAATACAAATCGAAAAATTTAAATTTATTTA
TAAAAATTTAGCCAGTTGCTGCCTATTGTATTGAAATAAAATACTGTAAAGGACACATTA
ATAACTATTATGCTTGATCTATCAGAAGTAATTTAAAATCTTAATGCATGTTGATTGAAC
AAATTTATTTTTATAATTTTATCATGAAAACTTATTTAGTATTTTATATGAAAAAATTAT
TTAAGCCTTGGACTTTTATGGAACAACTGGATAAATGGATAGAAATGATTACAAATCACT
TACAATCTTTATAAATAAATCTTGAAACATTAGATTAAATGAGAGCTAAAGGTATTTTAT
TACTAAATTCAAAAATTATAGTAAAAAGCAAACATTATATTAGTGGAGAAGCTGTTTAGA
GACTACAAAGAACCTGTTTTGGACTCTGATGGAAAATTAGTAAAATCAGATACCTAAATT
TCTCCTGAAGAAGAAGCAGAGTTAATTAAACTTAAAGTAAAATCTTAATTTATTAAACTT
ATAAACTAAATTTATTCAAATAAAGAGTAGTGTCCCTCTTCCAGAAGGCTCTCTTACATC
TAACTTAGGTATTCCTATAGTCATATTAGCAAATAAGGTATATTTTCTAAAGTTTACAAA
GAAACTTATCGTTTTTTAAACTAAATAAAGTCTGATTTGATTGCTTAGAGCAATGATCAA
TAAAGCTAAATTGTCTTATATTATTTAAGAAAGTATTGCCTTTAATGTATATAAATTTTA
ATAGTATTTTGATATCATATAATAATTTTGATAATTAAAGATGGTGCAAGTTTAGTCTTT
ACCTCTAGCAAAAACTAAGAAAGCTTAGAAATTTATTATGAATATATGCTTCATACATTA
TATGGTTTTAAAAACAAAAATAAGTCAGAAATATATACAATTGACTCTATTTTCATACCT
TCTGGTTCAGATAACTTAAATCTTTTAAAGTATATCCTTTTATTTTAATTTTTGTGTAAA
TAGTTATTAATTAATTTCTTTTTATAGGTAGAGTAACTCAACTATTTTTGAATAATGCGA
CTCTAAACCTTATGAGGAACTAGTTAAAAGACCTACTAGTAAGAATCAAAGATAGGAGGA
AGTTGTTTGCGAAGATGAACAAGAATTTTTAAAGAATTTAGTTAATGATAAGTCCAATCC
TGAACCTATATAAAGTGCTAAATCTTCAATTTCTGCTATTCTTTAATCAGGCACAAGTTC
GACTTCTACAAGAACAGTAAATCCTCCTATAGTAGGGAACTAAGGTACTACAAGTGTTGC
TAAATTCTACTAGACTCTACTTAACTAGCCAAATGATGTAAATAATTAAATATTTTAAAA
AGATAATAATCCTTTATTTTAATTATTTTAAATAGGCTAGAAGACTCAGAGAAAATGCTG
AAAGAGACTTACAACAAAGAGTTGGAAATAGTACAAATAATTATTTTAGAAACGACGAAA
TTTAGTAGGTCAAAGATATTATAAAAAAGCAAAATTGA