Identifiers and Description

Gene Model Identifier

TTHERM_00918500

Standard Name

CYT1 (CYTochrome c1)

Aliases

PreTt07045 | 163.m00047 | 3754.m00253

Description

Cytochrome C1 family protein; component of the mitochondrial respiratory chain

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 31.9%

TetraMine Data

TTHERM_00918500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19174.19.997093137033517e-262hypothetical protein (320 aa)
OxytrichaContig17316.0.g921.0000943968537097e-101Cytochrome C1 family
Stentor CoeruleusSteCoe_333018.194012623990515e-40
SGDYOR065W6.99697739292434e-35CYT1 Cytochrome c1, component
of the mitochondrial respirato
ry chain; expression is regula
ted by the heme-activated, glu
cose-repressed Hap2p/3p/4p/5p
CCAAT-binding complex
DictyBaseDDB_G02925942.0008113830639685e-30cyc1 on chromosome: 6 position
1821453 to 1822974
WormBaseWBGene000008692.0002795641672355e-21locus:cyc-1 status:Confirmed
UniProt:Q18853 protein_id
:CAA99820.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00918500(coding)
ATGAAGAGTTTCGTCGCTGCAGGTATTATCGGTTTGTCCTTAGCTAACTCCCAAAACAAG
GAAGTCTAGAATTTCATTTATAGAGATGATATTGGTGCTTTCTGGGGTATTAAGGGTTAT
GAAGAATTGGTTACCGAAGTTGGTACCCACAAGGGTCATAATTATTGGCCCCAATTTTCA
TTCTTGGGTACCTACGATTCTGGTTCAGTCAGAAGAGGTTTCCAAGTTTTTGCCAGAAAT
TGCGGTAACTGTCATGGTATGATTTACAAGAAGTACGATTACTTATTGGATAAGGCTTAC
AGATAATTAGAATTAGCTCAAATGGTTAGCGATTTCACTATTCACCCTGCCCATCAACAT
TTTAAACAATATTACTATCAAGAATGGGATGAGAGAGATAGAGTTATTTGCGATCACATC
TATCCTCCTTACTTCTCTTAGGATCAAGCTAAGAATGCTAACGGTGGTGTCTGGCCTACT
GATTTCTCTAAGATTAAGCTTAGACCTGGTGGTATTAACTACATTTATAACATTTCTACT
GGTTATCACTTCACTCCTCCTTTCGGTATGGATGTTCCTAAGGGCAAATACTTCAATCCT
TACTTCGATCACATGATTATTGGTATGCCCAGATAATTAGTTGATGGTTTGGTTGATTAC
GATGATGGTACCCCCGCTTCTACTCCCTAGATGGCTTATGATGTTTCTAACTTCATTAAC
TTCATGTAAAGAAGAGTTGGTTACAAGAGACCCGATAAGATGGTTAGATATTATATGGTC
TTCACTGGTGGTTTACTTATCCTTCCCTTCAAGTATTTCAAGACAAAGGCCTACTACAGA
AACCTTCTCTCCTTAAGATGGGAAATGTACGCTGTTAGAGATGGTGTTTACTACAATCAC
TTCAAATATGGTGGATACAATTCCAGAGCTTACTAATTCAGAGGTTACTTCTGGGCTTGA


>TTHERM_00918500(protein)
MKSFVAAGIIGLSLANSQNKEVQNFIYRDDIGAFWGIKGYEELVTEVGTHKGHNYWPQFS
FLGTYDSGSVRRGFQVFARNCGNCHGMIYKKYDYLLDKAYRQLELAQMVSDFTIHPAHQH
FKQYYYQEWDERDRVICDHIYPPYFSQDQAKNANGGVWPTDFSKIKLRPGGINYIYNIST
GYHFTPPFGMDVPKGKYFNPYFDHMIIGMPRQLVDGLVDYDDGTPASTPQMAYDVSNFIN
FMQRRVGYKRPDKMVRYYMVFTGGLLILPFKYFKTKAYYRNLLSLRWEMYAVRDGVYYNH
FKYGGYNSRAYQFRGYFWA


>TTHERM_00918500(gene)
ATGAAGAGTTTCGTCGCTGCAGGTATTATCGGTTTGTCCTTAGCTAACTCCCAAAACAAG
GAAGTCTAGAATTTCATTTATAGAGATGATATTGGTGCTTTCTGGGGTATTAAGGGTTAT
GAAGAATTGGTTACCGAAGTTGGTACCCACAAGGGTCATAATTATTGGCCCCAATTTTCA
TTCTTGGGTACCTACGATTCTGGTTCAGTCAGAAGAGGTTTCCAAGTTTTTGCCAGAAAT
TGCGGTAACTGTCATGGTATGATTTACAAGAAGTACGATTACTTATTGGATAAGGCTTAC
AGATAATTAGAATTAGCTCAAATGGTTAGCGATTTCACTATTCACCCTGCCCATCAACAT
TTTAAACAATATTACTATCAAGAATGGGATGAGAGAGATAGAGTTATTTGCGATCACATC
TATCCTCCTTACTTCTCTTAGGATCAAGCTAAGAATGCTAACGGTGGTGTCTGGCCTACT
GATTTCTCTAAGATTAAGCTTAGACCTGGTGGTATTAACTACATTTATAACATTTCTACT
GGTTATCACTTCACTCCTCCTTTCGGTATGGATGTTCCTAAGGGCAAATACTTCAATCCT
TACTTCGATCACATGATTATTGGTAAGCAAATCTTTTACTATTTTCAAAGAATATTCTTA
GCAGGAAGAAAAAATATAATTTTAAATTATAATTTCTAATTTAAAAAATGAAATGATAAG
CACAAACAGATATATTGAGATTGAAATATAGCCAAACGCATCAGAACTTGAACAAATTTT
TTATTTTTTACTCTAAGATTAAATATTTTAGAAATTGTTTGAAAGAAAGAAAGAAAGATA
TAAAATTTTTAGCAAAGTGGTTATTTTTACAAAAACAAATAAATCATAAGAAATGGAGAG
TTAAGAGAACTGAAAAATATAAAAAAATTAAGGCTTTATAGACATTTTTAATATAATTTA
GCAAAATATTTTTAAGCATAAATTCAAATTTTATAGTTATGAAATTAGAATTATTGATAC
AATATTAATATTAAAGTAAGATTGATTCAAAAATATGCCAATAAAATACGATTTGCATTA
ACAGCTTTTCAATAAAATTTTGTTAAGACCGATTTTAGTCATGAATAAGCTGCATAGGAT
CATTATTTGAAGCTTCTATGTGAAATAAATGAGTTTCCTTCATCAAAATTATAAAAATAT
CTTTTAGACCATAATTAAATTTTATTAAATTTCTAACTAAAATAATAAAGATATTTAATT
CAATTCTCTAAGAAATAAATATATTTGCAAATAAACTTAAGATCTATAAAACAAATTTTC
ATTAATTCATTCATTTAAATATCTTACCAGAAGTTATTCATCCATCACAAACAGATAGAC
TTGAATAATTTTCAAATTGCACTATTTTTAAATATATATTGCCTGCCTATTCAAAAAATA
TAAAAAAAAGATTCAATAAAATATAACATTTAAATGTAAAAGGTTTATTAACATATAAAT
TATAAAAAAAGGTATGCCCAGATAATTAGTTGATGGTTTGGTTGATTACGATGATGGTAC
CCCCGCTTCTACTCCCTAGATGGCTTATGATGTTTCTAACTTCATTAACTTCATGTAAAG
AAGAGTTGGTTACAAGAGACCCGATAAGATGGTTAGATATTATATGGTCTTCACTGGTGG
TTTACTTATCCTTCCCTTCAAGTATTTCAAGACAAAGGCCTACTACAGAAACCTTCTCTC
CTTAAGATGGGAAATGTACGCTGTTAGAGATGGTGTTTACTACAATCACTTCAAATATGG
TGGATACAATTCCAGAGCTTACTAATTCAGAGGTTACTTCTGGGCTTGA