Identifiers and Description

Gene Model Identifier

TTHERM_00881440

Standard Name

CYP1 (CYsteine Protease )

Aliases

PreTt09744 | 156.m00128 | CyP

Description

Putative cysteine protease; mRNA is specifically expressed during starvation; histone H1 and Hhp1p are required for efficient mRNA expression

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 90.2%

TetraMine Data

TTHERM_00881440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09211.15.9972846607022074e-127papain family cysteine proteas
e containing protein (324 aa)
OxytrichaContig322.1.g1162.0007467515522948e-59Papain family cysteine proteas
e
DictyBaseDDB_G02728153.998479955315009e-46cprE on chromosome: 2 position
2212329 to 2213613
WormBaseWBGene000007766.997646692526315e-42locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
Stentor CoeruleusSteCoe_149224.780892883885469e-25

General Information

Paragraph NoGene NameParagraph Text
9HHO1,
CDC2,
NgoA,
CYP1
HHO1 knockouts show no global increase or decrease in the amount of transcription in the cell; however, these same knockouts also show that Hho1p is important for the transcriptional regulation of individual genes in response to stimuli, such as starvation. The differential regulation of Hho1p by phosphorylation under vegetative growth and starvation conditions has been well studied. During vegetative growth, Hho1p is phosphorylated on five closely spaced residues, preventing it from interacting with chromatin, likely by interfering with its ability to bind DNA. Under these conditions, expression is increased for CDC2, a homolog of the cyclin dependent kinases responsible for histone H1 phosphorylation, possibly creating a positive feedback loop that promotes the cell cycle. During starvation conditions, Hho1p is dephosphorylated, allowing it to bind to chromatin. This stimulates the expression of some genes, including ngoA, and protease genes such as CYP1, while inhibiting expression of other genes, such as CDC2. This decrease in CDC2 expression may be responsible for cell cycle arrest during starvation.

Associated Literature

  1. Ref:12351190: Udani RA, Karrer KM (2002) ASI1, a gene encoding a novel leucine zipper protein, is induced during development of the macronucleus in Tetrahymena. Mechanisms of development 118(1-2):215-8
  2. Ref:12356861: Dou Y, Bowen J, Liu Y, Gorovsky MA (2002) Phosphorylation and an ATP-dependent process increase the dynamic exchange of H1 in chromatin. The Journal of cell biology 158(7):1161-70
  3. Ref:10983971: Dou Y, Gorovsky MA (2000) Phosphorylation of linker histone H1 regulates gene expression in vivo by creating a charge patch. Molecular cell 6(2):225-31
  4. Ref:10207086: Huang H, Smothers JF, Wiley EA, Allis CD (1999) A nonessential HP1-like protein affects starvation-induced assembly of condensed chromatin and gene expression in macronuclei of Tetrahymena thermophila. Molecular and cellular biology 19(5):3624-34
  5. Ref:9163512: Suzuki KM, Hosoya N, Takahashi T, Kosaka T, Hosoya H (1997) Release of a newly-identified cysteine protease, tetrain, from Tetrahymena into culture medium during the cell growth. Journal of biochemistry 121(4):642-7
  6. Ref:8756729: Shen X, Gorovsky MA (1996) Linker histone H1 regulates specific gene expression but not global transcription in vivo. Cell 86(3):475-83
  7. Ref:8464925: Karrer KM, Peiffer SL, DiTomas ME (1993) Two distinct gene subfamilies within the family of cysteine protease genes. Proceedings of the National Academy of Sciences of the United States of America 90(7):3063-7

Sequences

>TTHERM_00881440(coding)
ATGAATAAAAAATTCATCATTTTGAGTATTATCATGCTCATGCCTCTCTGTTTGGCTCAA
GATATAAGTGTAGAAAAACTTCTTGCTTATAATAAATGGTCAAGCTAAAATCAAAGAGCC
TATCTGAATGAAGATGAAAAACTGTATAGACAAATAGTTTTCTTTGAAAATTTGTAAAAA
ATTAAGGAGCATAACAGTAACCCTAATAACACCTATTCTATCCATTTAAACTAATTCTCA
GATATGACTAGAGAAGAATTTGCAGAAAAAATTCTTATGAAATAGGATTTGATTAACGAT
TATATGAAGGGAATTGGTTAATAGGCTACTCACAATAATGCTAATAACGAAACTTAAATG
AATTCATAAAACCATACTTTAGCTGCTTCTATAGATTGGAGAACAAAAGGTGCTGTAACA
TCGGTTAAGGATTAAGGTTAATGTGGTTCATGCTGGAGTTTCTCTGCAGCTGCCTTAATG
GAGTCATTTAACTTCATTTAAAACAAAGCTTTAGTTAATTTTTCTGAGTAATAACTTGTT
GATTGTGTGACCCCTGAAAATGGTTACCCCTCTTATGGATGTAAAGGAGGATGGCCTGCT
ACTTGTCTGGATTATGCCTCCAAAGTAGGTATCACAACACTAGACAAGTATCCCTATGTT
GCAGTACAGAAAAATTGTACTGTGACAGGTACAAATAATGGCTTTAAGCTTAAAAAGTGG
ATTGTAATTCCTAACACTTCAAACGACTTAAAAAGTGCTTTAAATTTCTCTCCTGTTTCT
GTTCTTGTTGATGCTACCAATTGGGATTATTATTCGTCTGGAATTTTCAACGGATGTAAT
TAAACTAATATTAATCTTAATCATGCTGTATTAGCTGTAGGCTATGACGAAAAAGATAAC
TGGATTGTTAAAAATTCTTGGAGCGCTGGTTGGGGTGAACATGGATATATTAGACTTGCT
CCTAACAATACATGTGGTATCTTAAGCTCTAATATATAAGTTACTGCTTGA


>TTHERM_00881440(protein)
MNKKFIILSIIMLMPLCLAQDISVEKLLAYNKWSSQNQRAYLNEDEKLYRQIVFFENLQK
IKEHNSNPNNTYSIHLNQFSDMTREEFAEKILMKQDLINDYMKGIGQQATHNNANNETQM
NSQNHTLAASIDWRTKGAVTSVKDQGQCGSCWSFSAAALMESFNFIQNKALVNFSEQQLV
DCVTPENGYPSYGCKGGWPATCLDYASKVGITTLDKYPYVAVQKNCTVTGTNNGFKLKKW
IVIPNTSNDLKSALNFSPVSVLVDATNWDYYSSGIFNGCNQTNINLNHAVLAVGYDEKDN
WIVKNSWSAGWGEHGYIRLAPNNTCGILSSNIQVTA


>TTHERM_00881440(gene)
ATGAATAAAAAATTCATCATTTTGAGTATTATCATGCTCATGCCTCTCTGTTTGGCTCAA
GATATAAGTGTAGAAAAACTTCTTGCTTATAATAAATGGTCAAGCTAAAATCAAAGAGCC
TATCTGAATGAAGATGAAAAACTGTATAGACAAATAGTTTTCTTTGAAAATTTGTAAAAA
ATTAAGGAGCATAACAGTAACCCTAATAACACCTATTCTATCCATTTAAACTAATTCTCA
GATATGACTAGAGAAGAATTTGCAGAAAAAATTCTTATGAAATAGGATTTGATTAACGAT
TATATGAAGGGAATTGGTTAATAGGCTACTCACAATAATGCTAATAACGAAACTTAAATG
AATTCATAAAACCATACTTTAGCTGCTTCTATAGATTGGAGAACAAAAGGTGCTGTAACA
TCGGTTAAGGATTAAGGTTAATGTGGTTCATGCTGGAGTTTCTCTGCAGCTGCCTTAATG
GAGTCATTTAACTTCATTTAAAACAAAGCTTTAGTTAATTTTTCTGAGTAATAACTTGTT
GATTGTGTGACCCCTGAAAATGGTTACCCCTCTTATGGATGTAAAGGAGGATGGCCTGCT
ACTTGTCTGGATTATGCCTCCAAAGTAGGTATCACAACACTAGACAAGTATCCCTATGTT
GCAGTACAGAAAAATTGTACTGTGACAGGTACAAATAATGGCTTTAAGCTTAAAAAGTGG
ATTGTAATTCCTAACACTTCAAACGACTTAAAAAGTGCTTTAAATTTCTCTCCTGTTTCT
GTTCTTGTTGATGCTACCAATTGGGATTATTATTCGTCTGGAATTTTCAACGGATGTAAT
TAAACTAATATTAATCTTAATCATGCTGTATTAGCTGTAGGCTATGACGAAAAAGATAAC
TGGATTGTTAAAAATTCTTGGAGCGCTGGTTGGGGTGAACATGGATATATTAGACTTGCT
CCTAACAATACATGTGGTATCTTAAGCTCTAATATATAAGTTACTGCTTGA