Identifiers and Description

Gene Model Identifier

TTHERM_00332170

Standard Name

CYC8 (CYClin)

Aliases

PreTt30324 | 33.m00336 | 3705.m00160

Description

Cyclin, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05594 ) hemagluttinin repeat
  • ( PF00134 ) cyclin, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00332170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20854.19.997093137033517e-262cyclin domain-containing prote
in (1584 aa)
OxytrichaContig14167.0.g675.999907735769095e-44Cyclin, N-terminal domain
WormBaseWBGene000008714.0013320766793207e-25locus:cye-1 G1/S-specific cy
clin-E status:Confirmed Un
iProt:O01501 protein_id:CCD6
6921.1
SGDYLR210W2.9990241513684e-21CLB4 B-type cyclin involved in
cell cycle progression; activ
ates Cdc28p to promote the G2/
M transition; may be involved
in DNA replication and spindle
assembly; accumulates during
S phase and G2, then targeted
for ubiquitin-mediated degrada
tion
Stentor CoeruleusSteCoe_155612.8625185805493937e-20
DictyBaseDDB_G02790857.001446474249442e-19cycA on chromosome: 3 position
1598641 to 1600602

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64
  2. Ref:SUPR000111

Sequences

>TTHERM_00332170(coding)
ATGTTTTCAAGTATAGCATCTTCAGCAAAAGGGAGTTAAAACAAAGAAATAAAAATCCCA
GTTGGAAATTAATCATAAAATTGTTACAATTACTAATAGACTTTCCAATCACAATAATAA
TTATAATAGCCTCAATAAGCTTAACCTTTATAGCAAGGCAATTAACGAAAGCCCTCTATA
TCTAGTGTTGCGAGACCTTAGAAATTTTCTATTTCTATATAGAATAAAGACCAGTCTTTG
CAATAAGAAATACTAAGTGATGATAGAAATTTAACTTATCATAAAAAAAAGCAATCTTAT
TAGCAGATGATCAGCTCAAACCATTAAGGAAGCATTTAAAACCAAAAGAAGAGTAAGCAA
AGCATTAATTTAAACAATCTATAAAATCTTAATTTAGCAAGTACAAATAACAACATTATA
AAGGGCTAATAGAATTAATAGAACTAATAAACTGCTTCGACATTTTCTATTCAAAATGCA
AAAAATTAGTATTAATAATCACAATAATAATTTAGCTCTGCAACTCTTAACTCGCAAAAC
AAAAACTCTGCCAAAGATTTTATTAATTATAAAATCCTATAAATACAGGCTAATAGTAGT
AAAAATTAATCTATTTCTAACGTTTAAATGAATGGGAATTTACAGCCTCAAAATTAAATT
CAAACCTAAATGAATGTCTAAATTTAAGGTAAAAGCAATTAATTCCTTCAAAATCATGGA
AGTGGAAATTCCAGTCAATAGCTTGTAATCACAAGCGCTAGACGTAACGAAAGTTCTTCA
GTCAATGTAAGATAAAGAGGAAACGAATAAATAAAAAACTAAAATAACCGCTAAGATTAA
TCTGACTTGAAAGACTAAACTTTAAATCAATATGAAGATATCTTAAAAGAAAAGTAAAAC
ATTTTGTAGCATCATTAAAATACAATGAATTAAACTCAAAGCAAAATGCAACCCTCATAA
TAACAAGTTATGATTAACAATTATACTTACCATACCAGTCAAAACAATTTAAAAAATGTA
AGCAGTAATTCATAATAATCTTAAAATATAAATAACTATCATTAAGTTAGTAACATTGAA
AATAACATCAATAATGCAAATACATAGTAAATTTAAGAAAGACCTAAACAAAATTCTTAA
TAATAAAATATTGGCTACTAAACCACCCACAATAATCATAAAAGTATTAACATCTAATAA
TCATAAAATTAAAATATAAATAATTACAATTGCAATATTGAAAATAATATTAATAGTGCT
AATTTGTAACCATTACTTGAAAAAAATAAATTTAATGTTTAATAATAACACTTTAACAGT
AATACTCTGAACTCATATTCCTTTCTCAGCAACAACAATAATATTAGCAGCACATCTAAT
TTTTCTTCTTTTGGAACACTTCCAAAAGGCACATCAGCTAGTATTTTGAAATAATAATAA
TAATAATAACAATAACAATAAAACACCCAAACAACTATTAATTCTATGCTATTGCATTTA
TAGTAAAATGACTTATAAAAAAATTACTTTTTAAATTAATAAAAAATTTAAAATAGCAGC
AACAACGGTTAGAATTAATATGCATATTAAAAGAATAATCAATTAGAAATCAATTCTGCT
TCTAATTTGGCTCTAACAGATTAAGATGCTTTGAAAGAGTTACTTAGCAAAACTACTTCA
ACAAAGAGTGCAATCAAAAACGCTGCCAACTACTTCTCTTCTCAACAACATAAATAATAA
GTTTAAAATAATATAAATCTTTAATAAGAAGAGAAACCTGGATTTTAATCTGAGCGTCTT
AACAACAACAACAATAATACAAACAATACTTAATTTATTCTTTAAAACCAAGTTGCTTAA
AAAAAAAATGAATGTATAAACAATTAAAATAAAATCAATGTTCAATCTCACTTAAAGGTT
TAAAATTAATAAAAAGCTTAAAACAATCCTAATAATTCTTAAGCAGTAGAACAAATGTAC
TAAAACTAAGCTCCCATCTAGAGAAAAATACAAGAAAAGATACAAAAATTTACATAAATA
TAAACATAAATTCAAAACTATAATCCAATCTAAACCTAAAATCTGACATAAAATTCTAAT
AAATCTCATTTAAAAGCAAACCCTATTTCTATATTGTCTTAGGTAAACTCGTATGGAATT
GTAAACAATTCAAAGTAGCCAACACCAGCAATACCCTCAGTTTCTTCTGTTAGCAGTACT
TAAAATCTTCATTAATAAAAAACTAATGAAACTCTTAGCAATTTTACTGTTTCTCCAAGT
GTTCCAAGTACTTAAGTGCAAATTACAAATCAAATAGGATTATTGAGCTCTAATTCAAAT
AATAGTACTAATAATAACAATATAAATAATAATTATTATAGTAATCTAAGTAACAAAGCC
GAATATCCACATATTTAAAATAATTAAATCGGAGTAAACAATATTAGTTAACTTGGATAG
TTGTCTGGATAATGTTCTAGTAATAACAATAACACGACTCAAAATAGTGCCTTAAATTAA
AATAATCATAAAAATTTGCTTTCAACTGCTATAAAATCCGAAACTACTCAGGTTTCTAAT
TTTAGTTAAGATTCTCCTCTTGTATGTAATGAAAATCTATCAGGAATTCTAACAAACAGA
TATGGCGATAATTCATAATTTAAAAATTTACTATCCTGCAAAAGCAACAACATGTCAAGT
AATAATATCAATCCAGGAACTTATAATAGCAACACTTCAAACAATATACACTAAAATTCA
TCATCTTTTACTTAAACTTTATCAGAAAACAAAGACAAAATACAAAATAATATTTAAATT
TAAAATTATATTTCTACTTAACATTAAACCTCTCAAATTAATTCAAAGATTGGAATCACT
AATATTTAATTAATTGAAGAATACGATAATTCGATTCCTTATAGTCAATCATAGTAATCT
TAAATTTTAAATAATTATGGTGCTTAGCCTAATAATGCTTCTAACAGTTAAAGCAATAAT
AATAATAATATTAATAATAGCAATTGTGGATTTAAACCTACTCATAAAAAGAATTTAAGC
AATCATCTTATAAATAAATTAGGAGCTATTTGCAAAAGTGCCACTGAAGGATCATAAACC
TATACCTAAAGTTCTCAAAATAACTCTTAAAACAAAGATTCTTTCAACAATAACAACAAC
ACTTTAAGCAGTAATTAAAATAAAACTAAAAATAATACTGTTAGTATTAGTCTAAATAAC
AATAACACTAATAATCTTTAAAGTAATACTTTGAGTTAAGTCCAAGATTTAGATCTCAAA
AAAGAAGATACTGTTGTCACAAATTATGAGTTAGAAGTTGTGGAAGAAAGCTTAAAAGAT
AGCATTGAGCAATTTAGTACTAAATAAAATGTTTAAATCAACAAAATACCAAATAACTTA
AAATTAGATAAATAAAAAAATAAAGAATAAAAGGAAAGTCTTGAATAGCAGCTTTTAAAT
TTCTAGCATTAAAATATCTTAAGTGAGAATTTCGAATACAGAATTAAGGATATGAAAGAA
TAGGAAATAGACTATCTGCCAAATCCAGATTATTTTGATAATTAAACAGAAATTACTTGT
ATGATGAGATGCATTCTATTTGATTGGATGTTTGATGTTTGCATGAGCCTCATGCTAAAA
AGAGAAACTGTTTATCTTTCTTTAAATTATGTTGATAGGTATCTCAGCTAAAAATAGGTT
ACAAAGCTTAACCTTTAACTTGTTGGAGCTGTTTCTCTTTATATGGCTTGTAAAATAGAA
GAAATTCAACCTCCTTCCATTTCAGAGTTTGCAAAATGTACTGATGATGGTTATACAGTA
GCATAAATTGTAGAATATGAACTGCTAATGTTAAAAGCTTTTGATTGGAAATTAAATCCA
CCAACATAAATAACTTGGTTGAACATGTATACTGAGATATGGGATAGATTCATAAAATCT
AGTTTTGATAAGCCAAATAAATATCAAATAAATTTTGTTTAAGATCAAAAGATTTCAAAC
AAGAATTACTTAATTCTCTACAGAATTCCTGAATAGAAAAGTTACATGCTTTTTAGATAA
ATGGTGTAGATTTTGGATTTAATGTAATTAGATGCTAATGTATTAAGATTTGAAAGCAGA
ATGCTAATTGCTTCATTAATGTACTTGTAGCTAGGCATTTATTATAAATAATTCACTAAA
AAATAAGTTCATTCAGGATTCAATGAAAAATACTTATTTGCTAATTCACTTAATAATTTC
AACGAATACTTTAATTCTTTTTTGACTCAGCACTTCTAATTTAATCTGATTGACATACTT
TCTACTTTGCAACATGTAGCAACTTTCTTTGACGTAGAATATAATTATTCACTTTCTCCA
GCAGCCTAAATGATTGATCCTACAAATAACGAGATGTCTTATGAAGAATATTTATCCTAT
TAAACTTATTTCCCTAATGGTATTGATTATATAAGGAAAAGATACTGCTCATGA


>TTHERM_00332170(protein)
MFSSIASSAKGSQNKEIKIPVGNQSQNCYNYQQTFQSQQQLQQPQQAQPLQQGNQRKPSI
SSVARPQKFSISIQNKDQSLQQEILSDDRNLTYHKKKQSYQQMISSNHQGSIQNQKKSKQ
SINLNNLQNLNLASTNNNIIKGQQNQQNQQTASTFSIQNAKNQYQQSQQQFSSATLNSQN
KNSAKDFINYKILQIQANSSKNQSISNVQMNGNLQPQNQIQTQMNVQIQGKSNQFLQNHG
SGNSSQQLVITSARRNESSSVNVRQRGNEQIKNQNNRQDQSDLKDQTLNQYEDILKEKQN
ILQHHQNTMNQTQSKMQPSQQQVMINNYTYHTSQNNLKNVSSNSQQSQNINNYHQVSNIE
NNINNANTQQIQERPKQNSQQQNIGYQTTHNNHKSINIQQSQNQNINNYNCNIENNINSA
NLQPLLEKNKFNVQQQHFNSNTLNSYSFLSNNNNISSTSNFSSFGTLPKGTSASILKQQQ
QQQQQQQNTQTTINSMLLHLQQNDLQKNYFLNQQKIQNSSNNGQNQYAYQKNNQLEINSA
SNLALTDQDALKELLSKTTSTKSAIKNAANYFSSQQHKQQVQNNINLQQEEKPGFQSERL
NNNNNNTNNTQFILQNQVAQKKNECINNQNKINVQSHLKVQNQQKAQNNPNNSQAVEQMY
QNQAPIQRKIQEKIQKFTQIQTQIQNYNPIQTQNLTQNSNKSHLKANPISILSQVNSYGI
VNNSKQPTPAIPSVSSVSSTQNLHQQKTNETLSNFTVSPSVPSTQVQITNQIGLLSSNSN
NSTNNNNINNNYYSNLSNKAEYPHIQNNQIGVNNISQLGQLSGQCSSNNNNTTQNSALNQ
NNHKNLLSTAIKSETTQVSNFSQDSPLVCNENLSGILTNRYGDNSQFKNLLSCKSNNMSS
NNINPGTYNSNTSNNIHQNSSSFTQTLSENKDKIQNNIQIQNYISTQHQTSQINSKIGIT
NIQLIEEYDNSIPYSQSQQSQILNNYGAQPNNASNSQSNNNNNINNSNCGFKPTHKKNLS
NHLINKLGAICKSATEGSQTYTQSSQNNSQNKDSFNNNNNTLSSNQNKTKNNTVSISLNN
NNTNNLQSNTLSQVQDLDLKKEDTVVTNYELEVVEESLKDSIEQFSTKQNVQINKIPNNL
KLDKQKNKEQKESLEQQLLNFQHQNILSENFEYRIKDMKEQEIDYLPNPDYFDNQTEITC
MMRCILFDWMFDVCMSLMLKRETVYLSLNYVDRYLSQKQVTKLNLQLVGAVSLYMACKIE
EIQPPSISEFAKCTDDGYTVAQIVEYELLMLKAFDWKLNPPTQITWLNMYTEIWDRFIKS
SFDKPNKYQINFVQDQKISNKNYLILYRIPEQKSYMLFRQMVQILDLMQLDANVLRFESR
MLIASLMYLQLGIYYKQFTKKQVHSGFNEKYLFANSLNNFNEYFNSFLTQHFQFNLIDIL
STLQHVATFFDVEYNYSLSPAAQMIDPTNNEMSYEEYLSYQTYFPNGIDYIRKRYCS


>TTHERM_00332170(gene)
ATGTTTTCAAGTATAGCATCTTCAGCAAAAGGGAGTTAAAACAAAGAAATAAAAATCCCA
GTTGGAAATTAATCATAAAATTGTTACAATTACTAATAGACTTTCCAATCACAATAATAA
TTATAATAGCCTCAATAAGCTTAACCTTTATAGCAAGGCAATTAACGAAAGCCCTCTATA
TCTAGTGTTGCGAGACCTTAGAAATTTTCTATTTCTATATAGGTAAAATATATTTATGAA
TATTGATTATGTAAACTATTAAGTCTAAAACCATGCATTTTTTAATAAACATTCACATTA
AGACTTAATCTATATTATTTTAAGATTGAACGTTTGAGTCAATAAAAAATCTCTTAAGTA
TTTTAAAAGTTGAATTTGAAAAATTGCATGCTTTTTAACCTTAATAAATTACATTTAATT
TTTAAAATTTACAAAAATGCATTAAGATTGAAATTATGTTGTTAAAATAATTTTTGAAGA
CAAGACATACAAAAAATTATCAAATATAAGATAGAAAACTTAATAATTATTAAAGCTATT
TTTAAATTAATTTTAGAATAAAGACCAGTCTTTGCAATAAGAAATACTAAGTGATGATAG
AAATTTAACTTATCATAAAAAAAAGCAATCTTATTAGCAGATGATCAGCTCAAACCATTA
AGGAAGCATTTAAAACCAAAAGAAGAGTAAGCAAAGCATTAATTTAAACAATCTATAAAA
TCTTAATTTAGCAAGTACAAATAACAACATTATAAAGGGCTAATAGAATTAATAGAACTA
ATAAACTGCTTCGACATTTTCTATTCAAAATGCAAAAAATTAGTATTAATAATCACAATA
ATAATTTAGCTCTGCAACTCTTAACTCGCAAAACAAAAACTCTGCCAAAGATTTTATTAA
TTATAAAATCCTATAAATACAGGCTAATAGTAGTAAAAATTAATCTATTTCTAACGTTTA
AATGAATGGGAATTTACAGCCTCAAAATTAAATTCAAACCTAAATGAATGTCTAAATTTA
AGGTAAAAGCAATTAATTCCTTCAAAATCATGGAAGTGGAAATTCCAGTCAATAGCTTGT
AATCACAAGCGCTAGACGTAACGAAAGTTCTTCAGTCAATGTAAGATAAAGAGGAAACGA
ATAAATAAAAAACTAAAATAACCGCTAAGATTAATCTGACTTGAAAGACTAAACTTTAAA
TCAATATGAAGATATCTTAAAAGAAAAGTAAAACATTTTGTAGCATCATTAAAATACAAT
GAATTAAACTCAAAGCAAAATGCAACCCTCATAATAACAAGTTATGATTAACAATTATAC
TTACCATACCAGTCAAAACAATTTAAAAAATGTAAGCAGTAATTCATAATAATCTTAAAA
TATAAATAACTATCATTAAGTTAGTAACATTGAAAATAACATCAATAATGCAAATACATA
GTAAATTTAAGAAAGACCTAAACAAAATTCTTAATAATAAAATATTGGCTACTAAACCAC
CCACAATAATCATAAAAGTATTAACATCTAATAATCATAAAATTAAAATATAAATAATTA
CAATTGCAATATTGAAAATAATATTAATAGTGCTAATTTGTAACCATTACTTGAAAAAAA
TAAATTTAATGTTTAATAATAACACTTTAACAGTAATACTCTGAACTCATATTCCTTTCT
CAGCAACAACAATAATATTAGCAGCACATCTAATTTTTCTTCTTTTGGAACACTTCCAAA
AGGCACATCAGCTAGTATTTTGAAATAATAATAATAATAATAACAATAACAATAAAACAC
CCAAACAACTATTAATTCTATGCTATTGCATTTATAGTAAAATGACTTATAAAAAAATTA
CTTTTTAAATTAATAAAAAATTTAAAATAGCAGCAACAACGGTTAGAATTAATATGCATA
TTAAAAGAATAATCAATTAGAAATCAATTCTGCTTCTAATTTGGCTCTAACAGATTAAGA
TGCTTTGAAAGAGTTACTTAGCAAAACTACTTCAACAAAGAGTGCAATCAAAAACGCTGC
CAACTACTTCTCTTCTCAACAACATAAATAATAAGTTTAAAATAATATAAATCTTTAATA
AGAAGAGAAACCTGGATTTTAATCTGAGCGTCTTAACAACAACAACAATAATACAAACAA
TACTTAATTTATTCTTTAAAACCAAGTTGCTTAAAAAAAAAATGAATGTATAAACAATTA
AAATAAAATCAATGTTCAATCTCACTTAAAGGTTTAAAATTAATAAAAAGCTTAAAACAA
TCCTAATAATTCTTAAGCAGTAGAACAAATGTACTAAAACTAAGCTCCCATCTAGAGAAA
AATACAAGAAAAGATACAAAAATTTACATAAATATAAACATAAATTCAAAACTATAATCC
AATCTAAACCTAAAATCTGACATAAAATTCTAATAAATCTCATTTAAAAGCAAACCCTAT
TTCTATATTGTCTTAGGTAAACTCGTATGGAATTGTAAACAATTCAAAGTAGCCAACACC
AGCAATACCCTCAGTTTCTTCTGTTAGCAGTACTTAAAATCTTCATTAATAAAAAACTAA
TGAAACTCTTAGCAATTTTACTGTTTCTCCAAGTGTTCCAAGTACTTAAGTGCAAATTAC
AAATCAAATAGGATTATTGAGCTCTAATTCAAATAATAGTACTAATAATAACAATATAAA
TAATAATTATTATAGTAATCTAAGTAACAAAGCCGAATATCCACATATTTAAAATAATTA
AATCGGAGTAAACAATATTAGTTAACTTGGATAGTTGTCTGGATAATGTTCTAGTAATAA
CAATAACACGACTCAAAATAGTGCCTTAAATTAAAATAATCATAAAAATTTGCTTTCAAC
TGCTATAAAATCCGAAACTACTCAGGTTTCTAATTTTAGTTAAGATTCTCCTCTTGTATG
TAATGAAAATCTATCAGGAATTCTAACAAACAGATATGGCGATAATTCATAATTTAAAAA
TTTACTATCCTGCAAAAGCAACAACATGTCAAGTAATAATATCAATCCAGGAACTTATAA
TAGCAACACTTCAAACAATATACACTAAAATTCATCATCTTTTACTTAAACTTTATCAGA
AAACAAAGACAAAATACAAAATAATATTTAAATTTAAAATTATATTTCTACTTAACATTA
AACCTCTCAAATTAATTCAAAGATTGGAATCACTAATATTTAATTAATTGAAGAATACGA
TAATTCGATTCCTTATAGTCAATCATAGTAATCTTAAATTTTAAATAATTATGGTGCTTA
GCCTAATAATGCTTCTAACAGTTAAAGCAATAATAATAATAATATTAATAATAGCAATTG
TGGATTTAAACCTACTCATAAAAAGAATTTAAGCAATCATCTTATAAATAAATTAGGAGC
TATTTGCAAAAGTGCCACTGAAGGATCATAAACCTATACCTAAAGTTCTCAAAATAACTC
TTAAAACAAAGATTCTTTCAACAATAACAACAACACTTTAAGCAGTAATTAAAATAAAAC
TAAAAATAATACTGTTAGTATTAGTCTAAATAACAATAACACTAATAATCTTTAAAGTAA
TACTTTGAGTTAAGTCCAAGATTTAGATCTCAAAAAAGAAGATACTGTTGTCACAAATTA
TGAGTTAGAAGTTGTGGAAGAAAGCTTAAAAGATAGCATTGAGCAATTTAGTACTAAATA
AAATGTTTAAATCAACAAAATACCAAATAACTTAAAATTAGATAAATAAAAAAATAAAGA
ATAAAAGGAAAGTCTTGAATAGCAGCTTTTAAATTTCTAGCATTAAAATATCTTAAGTGA
GAATTTCGAATACAGAATTAAGGATATGAAAGAATAGGAAATAGACTATCTGCCAAATCC
AGATTATTTTGATAATTAAACAGAAATTACTTGTATGATGAGATGCATTCTATTTGATTG
GATGTTTGATGTTTGCATGAGCCTCATGCTAAAAAGAGAAACTGTTTATCTTTCTTTAAA
TTATGTTGATAGGTATCTCAGCTAAAAATAGGTTACAAAGCTTAACCTTTAACTTGTTGG
AGCTGTTTCTCTTTATATGGCTTGTAAAATAGAAGAAATTCAACCTCCTTCCATTTCAGA
GTTTGCAAAATGTACTGATGATGGTTATACAGTAGCATAAATTGTAGAATATGAACTGCT
AATGTTAAAAGTAATTAATTTATTATTAAAATATCTTTTCATTCAAATAAATTTTAATTA
GCTTATATAAAATAACAAAAATAATAAATACCTTACTTACTTATTAATTAATTAATTAAT
TAATAAAGCGATTTATCTCCAAAAGTTTTTTAAAATACAAATGAATTTGTTTGGAGGAAG
ATAAAAATTAAGAATAAATTAGAAATTACAATAATAATTAAGATAAAAAGCAATTTTTTA
AAAACTTTTAATTTAGATAGTTCAAAAAATATATATGAATATTTAAAATATTTTTATTTT
TAATTATTATTAAATAAATAAAAATAAATTATAATAATAAATAGGCTTTTGATTGGAAAT
TAAATCCACCAACATAAATAACTTGGTTGAACATGTATACTGAGATATGGGATAGATTCA
TAAAATCTAGTTTTGATAAGCCAAATAAATATCAAATAAATTTTGTTTAAGATCAAAAGA
TTTCAAACAAGAATTACTTAATTCTCTACAGAATTCCTGAATAGAAAAGTTACATGCTTT
TTAGATAAATGGTGTAGATTTTGGATTTAATGTAATTAGATGCTAATGTATTAAGATTTG
AAAGCAGAATGCTAATTGCTTCATTAATGTACTTGTAGCTAGGCATTTATTATAAATAAT
TCACTAAAAAATAAGTTCATTCAGGATTCAATGAAAAATACTTATTTGCTAATTCACTTA
ATAATTTCAACGAATACTTTAATTCTTTTTTGACTCAGCACTTCTAATTTAATCTGATTG
ACATACTTTCTACTTTGCAACATGTAGCAACTTTCTTTGACGTAGAATATAATTATTCAC
TTTCTCCAGCAGCCTAAATGATTGATCCTACAAATAACGAGGTAAATATTATAATTCACT
TTAAAAATATATAATTAAATAAATTTATTTATTTATTTCAATAGATGTCTTATGAAGAAT
ATTTATCCTATTAAACTTATTTCCCTAATGGTATTGATTATATAAGGAAAAGATACTGCT
CATGA