Identifiers and Description

Gene Model Identifier

TTHERM_00293270

Standard Name

CYC7 (CYClin 7)

Aliases

PreTt15537 | 27.m00197 | 3692.m00001

Description

Cyclin, N-terminal domain containing protein; regulates activity of cyclin-dependent kinases; expressed during growth phase and conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00134 ) cyclin, N-terminal domain
  • ( PF02984 ) Cyclin, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00293270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08686.19.997093137033517e-262cyclin domain-containing prote
in (405 aa)
OxytrichaContig14947.0.g371.9998745702418095e-48Cyclin, N-terminal domain
DictyBaseDDB_G02790850.000000000000005001692698841201cycA on chromosome: 3 position
1598641 to 1600602
WormBaseWBGene000008650.00000000000001000191320216021locus:cyb-1 G2/mitotic-speci
fic cyclin-B1 status:Confirm
ed UniProt:Q10653 protein_
id:CAA94384.1
SGDYPR120C0.00000000000020009182674645818CLB5 B-type cyclin involved in
DNA replication during S phas
e; activates Cdc28p to promote
initiation of DNA synthesis;
functions in formation of mito
tic spindles along with Clb3p
and Clb4p; most abundant durin
g late G1 phase
Stentor CoeruleusSteCoe_200660.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64
  2. Ref:SUPR000110

Sequences

>TTHERM_00293270(coding)
ATGAATTCCTAAGTAGAAATATAATCTATGCCTTCTGAATAGACCTTCTTATCTTATGAA
AATGCCTGCCACGCTGGAGTTTAGTAGAAGTTCTACAACAATTCTTTAGCCTAAAAGAGT
GCTGCTGGTTTCCGTGGAGGTGAGTGCATCCGTAAGAAAGCTAAGAACTGTTAAATTAAT
ATTGTCAATCCTCAAAAAGAAATATCTGCTGCTGATTGTATGGAAATTGAAGATGATTGC
AATTTGAAGTAAAAATAAAACTTTGAGCAGTAATAGTAGCAAGATTAAAGAACAACCGAG
TGCAATTCTTTTTCTGACTACTTTACCAGCAAAAGATTTTAATAAATTTAAGTTCTATTA
AAGAGCGCTTCCAACGAAGAAGCTTACTCATCTAGAATAATTTCTTCTATGATTAATAGT
TAAAAATCACCAAGTGACTTCTTGCAAAACCACACAATAACTCCTGAAATAAGAGCAAAG
ATGATTGACTGGATGATTGAGGTTACAACAAGCTATGGTTAGAGTGATTAAACCTTCTTC
TTGGCAGTACAATACATGGACGCATTTTTCTAAAACTCTTAAAGATAGTTAACTCCTCAA
GATTTACATTTGACTGGTGTTGCTAGCATGTTTATTGCCTGCAAATATGAAGAAATATAT
CCTCTTCGTCTCTAAACCTTCTATGAAAAAATTGGTCACAAGAAATTGTCTATTTCAGAT
ATCAAGTAAAGAGAACAAGAAATATTGGCCTCTATAGATTTTGATTTAAGTTCTCCCACT
ATCCTTGACTTTATGGCTGTAACAGTCCAAAAATTAAATTTAGAAGAACACCTTCTTGAC
ACACATCTTACTTTTTTCCGTAAAATGTGTATTTACCTTGCAAAAATGGTATCACATGAA
TATTCTATCATTAATAACCATAACCAAACTACTATTGCTGGAGCAATTATCTATGTTTCT
TTTAAAATCCTTTAATAAATGTACAATGAATTTAATCTTGTTGCCCTTATACAACAAGTT
ATCTAAATTCTAAGCTTAAACAATGAAGAAATTCTTAAGGCTTCTACTCTTTTGCTTAAT
CTTGCAAGAAGTTTTGAGAGATAATATCCTAACTTGAATAATTTAAGAAAATTTAGTGCA
GATATCCAATAAATAAGTGCTTCTCCCTCTTCATCTTCACTAAAACCAACAAACCAATAA
CAAAGAAGAGCAAATAACTGA


>TTHERM_00293270(protein)
MNSQVEIQSMPSEQTFLSYENACHAGVQQKFYNNSLAQKSAAGFRGGECIRKKAKNCQIN
IVNPQKEISAADCMEIEDDCNLKQKQNFEQQQQQDQRTTECNSFSDYFTSKRFQQIQVLL
KSASNEEAYSSRIISSMINSQKSPSDFLQNHTITPEIRAKMIDWMIEVTTSYGQSDQTFF
LAVQYMDAFFQNSQRQLTPQDLHLTGVASMFIACKYEEIYPLRLQTFYEKIGHKKLSISD
IKQREQEILASIDFDLSSPTILDFMAVTVQKLNLEEHLLDTHLTFFRKMCIYLAKMVSHE
YSIINNHNQTTIAGAIIYVSFKILQQMYNEFNLVALIQQVIQILSLNNEEILKASTLLLN
LARSFERQYPNLNNLRKFSADIQQISASPSSSSLKPTNQQQRRANN


>TTHERM_00293270(gene)
ATGAATTCCTAAGTAGAAATATAATCTATGCCTTCTGAATAGACCTTCTTATCTTATGAA
AATGCCTGCCACGCTGGAGTTTAGTAGAAGTTCTACAACAATTCTTTAGCCTAAAAGAGT
GCTGCTGGTTTCCGTGGAGGTGAGTGCATCCGTAAGAAAGCTAAGAACTGTTAAATTAAT
ATTGTCAATCCTCAAAAAGAAATATCTGCTGCTGATTGTATGGAAATTGAAGATGATTGC
AATTTGAAGTAAAAATAAAACTTTGAGCAGTAATAGTAGCAAGATTAAAGAACAACCGAG
TGCAATTCTTTTTCTGACTACTTTACCAGCAAAAGATTTTAATAAATTTAAGTTCTATTA
AAGAGCGCTTCCAACGAAGAAGCTTACTCATCTAGAATAATTTCTTCTATGATTAATGTA
AACAATTAATTTCATTTATCTACTTAATAATTCCATTTTTAAGTATTTCCGATGACTTAT
TTTCTATTGTTAATTTATTAATTTACTTATTAACAAACATATCAGCATTCAATTAATTCT
CCCCAATTTTTGAAATTCACATTCATTTGCAAATTAAATTTTTAATCTTGATATGCTTGC
TTGTCTCACCCATTATTAAATAGATACTAAATTTTTTAATTAATTAATTAATATTTTCTT
TGGATATGAAAATCAATACAATACAACACAACACAACACTATCATCTTTTAATAGCAGTA
TTCTATCTATTTTGCTAATTATCATACTCTTTTTAAGACATATGGATTACTTATTTATGA
TATAAAAAATTTGAAAAAATCTATAAATCTGATTATTGGATTAATCCAAATCATTATCTA
AAAATCTTAAGATTTATATTCATTTTTTTTTATAACATTCATAGAGTTAAAAATCACCAA
GTGACTTCTTGCAAAACCACACAATAACTCCTGAAATAAGAGCAAAGATGATTGACTGGA
TGATTGAGGTTACAACAAGCTATGGTTAGAGTGATTAAACCTTCTTCTTGGCAGTACAAT
ACATGGACGCATTTTTCTAAAACTCTTAAAGGTAATTAAAATTAATTTAAAAAAATATTT
TTTGATATCAAAGTTGATTACTGATTTAAAGTTAATTTGATTAACACTATAACTTTTCCC
ATATTAAATTCTAATATTTTTAAAATCCGTCACATTTCTAATTCTAAATGATTAAATTAG
ATCATTTAATATTATTTCCCTCCATAAAGTTTGCATAAAAACGCTAATTTATTAAAAATT
AACACAATAAAGAAATTTAAAATTTTTCAATTCTTTTTGATAATAATTATTATTATTTTG
CATTCAATCTTTCCTTCCTTCCCGACCTTATTTAATTAATTAATTAAATAAATAAATAAA
AAATAATTAATAATACTGATAATTCCTAAATAAAAATTTTTCCTTTCTAGGTTTTTAACA
TGTTTTAATTTTAATATTTTAAATATTAATAGATAGTTAACTCCTCAAGATTTACATTTG
ACTGGTGTTGCTAGCATGTTTATTGCCTGCAAATATGAAGAAATATATCCTCTTCGTCTC
TAAACCTTCTATGAAAAAATTGGTCACAAGAAATTGTCTATTTCAGATATCAAGTAAAGA
GAACAAGAAATATTGGCCTCTATAGATTTTGATTTAAGTTCTCCCACTATCCTTGACTTT
ATGGCTGTAACAGTCCAAAAATTAAATTTAGAAGAACACCTTCTTGACACACATCTTACT
TTTTTCCGTAAAATGTGTATTTACCTTGCAAAAATGGTATCACATGAATATTCTATCATT
AATAACCATAACCAAACTACTATTGCTGGAGCAATTATCTATGTTTCTTTTAAAATCCTT
TAATAAATGTACAATGAATTTAATCTTGTTGCCCTTATACAACAAGTTATCTAAATTCTA
AGCTTAAACAATGAAGAAATTCTTAAGGCTTCTACTCTTTTGCTTAATCTTGCAAGAAGT
TTTGAGAGATAATATCCTAACTTGAATAATTTAAGAAAATTTAGTGCAGATATCCAATAA
ATAAGTGCTTCTCCCTCTTCATCTTCACTAAAACCAACAAACCAATAACAAAGAAGAGCA
AATAACTGA