Identifiers and Description

Gene Model Identifier

TTHERM_00194440

Standard Name

CYC6 (CYClin 6)

Aliases

PreTt06728 | 16.m00384

Description

Cyclin, N-terminal domain containing protein; regulates activity of cyclin-dependent kinases

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00134 ) cyclin, N-terminal domain
  • ( PF02984 ) Cyclin, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00194440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03715.19.997093137033517e-262cyclin domain-containing prote
in (625 aa)
OxytrichaContig19213.0.g104.998816730869543e-67Cyclin, N-terminal domain
DictyBaseDDB_G02754931.9991939848149086e-44cycB on chromosome: 2 position
6000211 to 6001649
SGDYLR210W3.000619078166531e-39CLB4 B-type cyclin involved in
cell cycle progression; activ
ates Cdc28p to promote the G2/
M transition; may be involved
in DNA replication and spindle
assembly; accumulates during
S phase and G2, then targeted
for ubiquitin-mediated degrada
tion
WormBaseWBGene000008654.001416569413617e-37locus:cyb-1 G2/mitotic-speci
fic cyclin-B1 status:Confirm
ed UniProt:Q10653 protein_
id:CAA94384.1
Stentor CoeruleusSteCoe_327355.900090541597061e-29

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64
  2. Ref:SUPR000109

Sequences

>TTHERM_00194440(coding)
ATGGATTTTTAAGACTTCTATGCTAACTATTTGCGCTAATAGCAAATATAGAAAGCATGT
GACAATATGAAATAAGATGAAGTTGATTACGATATGTCTCAGGCTAATACCTTATCAAAC
TATACTAGTAGGACAACAATAAATTCTAATTTTAATTAAAACTAGTATCCAATGCAGGAT
GAATCATCTACATAAACCCTGTTGTTGAATGGATCTAACTAAAATCAAAAAGGAATAGTA
GGTTTCACTAATAATAACTTAAAGAATTAACAAAAGCTTCTTGATGTAAATAACTAAAGA
GTCTTTGGAAGAGAACTCATAAATATTGATCAAGAAAGGACCTTTGCATAAAATAACATA
TAAAATAATAGCAAGAATCAATAGAGCTAGAATTATTCTAAGCCTACTGGATATTCATAA
ATTGAGAAATAAAATTACGCCTAAACATGCAACAACAATAACAAATAATTGAGTGATTAA
AATAATTTACAATAATAAAATAATCTTAATCAAATAAAATGTAACATGTCTGTAGAATGT
GATGGTCAAAATTTAAAAGGAGAAAATTAATAAAAATTAATTGATGTTAATAATTAAAGA
GTCTTTGGTAGAGATATTGCGAACGTCGATCAAGAAAGAACATTTTCATAAAATAATATG
CAAAATAGTTGCAAAATTCAGTAAAGTCAGAATTATGCAAAACCTATGGGGTACACAAAG
ATAGAAAAGCAGAATTATATGTAAGTTCAAAATAAAGATGAAAATTAAATCTACGCTAAT
CATACTAAGAACAATATGTATGTTGAATATGATGGTTAAAATCAATAAAAACTTGCTAAT
CCCAACAGTTAGCGCGTTTATGCCAAAGAAACAACAATTTCTGACCAAGAAAGACTGCAA
CAATAAAATAATATTCAAAATAATTTCAAGTCTCAACAAAACTAGAACTTTGCAAAGCCA
CTTGGATATACTAAATTAGATAAGTAAAACGTTTAAAACAATAACCAATTAGAATAAAAT
AGCTAACAATAAAGTAACTGCTTCAATTAACTAAAACGTCACATGTCTCTTGAATGCATC
AATGGTGATGACAACCAAAATATAAAATGTGAGAGCAACTTCTATTCTCGTAATAGTATG
GCAAGCTAATAAATGTAAGATGAAAATTATCATGCGGCTTCAAATGGATTTTCCAACAAC
AACAACACCTATAAAGCTAATACTTGCAAAGCTTCTTACGATAAAGAGAATTTCAATCAA
ATATCAACTGGATTTAGTGGATTAACTTAGTCAGTTCAATAAAATATAACTTTTAGATAA
AAAAATGTGATGGATGTCGAAAACTCTCAACAATCTCATGCAACCACTTACAGGTCTTTG
GAAAGAAAATAAGTAGTTGAATACACCTTCCCTAAAGACACACTTCAAAAAGATCCTATT
TACTAATACGCAAGGACAATTTTTGATTATCTACGTAGCAACGAAGAAGCGTATTGCGCT
AAAGGGACTATGAACAAAGTGTAAGATGAAATAACTGCTAGAATGAGAGCTATTATGGTA
GACTGGATAGTTGATGTGCATCTCAAATTTAAGCTCTTACCTGACACACTATATTTGACT
ATTAATTTGATCGACAGATATATTGAAAGAAAGTAAATTTCCAAAGATAGATTACAACTT
CTAGGTGCTACTTCAATGTTCATAGCTTGTAAATTTGAAGAAATTTATCCACCTGAGATT
AATGACTTTGTGTTTATATGTGATAGTCTCTATACAAAGGAATAAATATTATAAATGGAG
GGTGAATTAATCACAGCAATTAATTTTGATTTAACTTACACCAGTCCTTTACGTTTTCTT
AACAGATATAGTTACCTGAATGAATCCACTGAAGTATAATACTATTGTGCACAATATCTT
TTAGAGCTCTCTCTAATTGAGTATAAAATGACTGAGTATTCTTCATCAAACTAAGCTGCA
AGTGCACTATATTTAGTAAATAAAATATTTGACTAACCATGGAGTGAAGAGCTTCGCAAC
CAATCCCACTATGATTAGTCTTCTCTTAAAAAATGCGCTAAAGATATGTACGCTCTTCTT
TAAAAGGCAAATGAGTTCTAATACAAGTATCAGATTTAGGTTGCAGAGTATGAAAATTAA
AAATAACTACAGATGGCTTAATTAAAACAATGGTATAACCTTGAAAAGTCTAGACTAGAA
TAAGAATAGAATTTTGTCTAAGATCATCACGAATAATTAGAAATAGACTACGACCAAAAG
AGAAAAGAAATAGAAGCTAAATTCAAAGAAATCAAAGGCTAATTACTATGCAATAATAAA
AACTTAGTAGCAATTATCCGTAAATTTTCTCTTGCTGAATTCAAAGAGCCTGCTAAATTT
CTGTTTTGCCTAGAGTATCCTTTGCCCTGA


>TTHERM_00194440(protein)
MDFQDFYANYLRQQQIQKACDNMKQDEVDYDMSQANTLSNYTSRTTINSNFNQNQYPMQD
ESSTQTLLLNGSNQNQKGIVGFTNNNLKNQQKLLDVNNQRVFGRELINIDQERTFAQNNI
QNNSKNQQSQNYSKPTGYSQIEKQNYAQTCNNNNKQLSDQNNLQQQNNLNQIKCNMSVEC
DGQNLKGENQQKLIDVNNQRVFGRDIANVDQERTFSQNNMQNSCKIQQSQNYAKPMGYTK
IEKQNYMQVQNKDENQIYANHTKNNMYVEYDGQNQQKLANPNSQRVYAKETTISDQERLQ
QQNNIQNNFKSQQNQNFAKPLGYTKLDKQNVQNNNQLEQNSQQQSNCFNQLKRHMSLECI
NGDDNQNIKCESNFYSRNSMASQQMQDENYHAASNGFSNNNNTYKANTCKASYDKENFNQ
ISTGFSGLTQSVQQNITFRQKNVMDVENSQQSHATTYRSLERKQVVEYTFPKDTLQKDPI
YQYARTIFDYLRSNEEAYCAKGTMNKVQDEITARMRAIMVDWIVDVHLKFKLLPDTLYLT
INLIDRYIERKQISKDRLQLLGATSMFIACKFEEIYPPEINDFVFICDSLYTKEQILQME
GELITAINFDLTYTSPLRFLNRYSYLNESTEVQYYCAQYLLELSLIEYKMTEYSSSNQAA
SALYLVNKIFDQPWSEELRNQSHYDQSSLKKCAKDMYALLQKANEFQYKYQIQVAEYENQ
KQLQMAQLKQWYNLEKSRLEQEQNFVQDHHEQLEIDYDQKRKEIEAKFKEIKGQLLCNNK
NLVAIIRKFSLAEFKEPAKFLFCLEYPLP


>TTHERM_00194440(gene)
AACAAAAAATATTAAAAAATTAGAAAAAAAACACTCTTAAAAAAGTATAATAGAGATTAT
CGGGAGTCAGGATTTTCTTTCTCATTTTATCCACCATTTTCAAATATATTTTAAACAGCT
TGCTCAAATTTATAAAACTCTTATACAAGATAAATTATGGATTTTTAAGACTTCTATGCT
AACTATTTGCGCTAATAGCAAATATAGAAAGCATGTGACAATATGAAATAAGATGAAGTT
GATTACGATATGTCTCAGGCTAATACCTTATCAAACTATACTAGTAGGACAACAATAAAT
TCTAATTTTAATTAAAACTAGTATCCAATGCAGGATGAATCATCTACATAAACCCTGTTG
TTGAATGGATCTAACTAAAATCAAAAAGGAATAGTAGGTTTCACTAATAATAACTTAAAG
AATTAACAAAAGCTTCTTGATGTAAATAACTAAAGAGTCTTTGGAAGAGAACTCATAAAT
ATTGATCAAGAAAGGACCTTTGCATAAAATAACATATAAGTAAAATAAATTTCACATTTA
TACATTATTTTAAATTGAGTAAGTATTTAATCATTTTATTAATACAATTTTATTTTACAG
AATAATAGCAAGAATCAATAGAGCTAGAATTATTCTAAGCCTACTGGATATTCATAAATT
GAGAAATAAAATTACGCCTAAACATGCAACAACAATAACAAATAATTGAGTGATTAAAAT
AATTTACAATAATAAAATAATCTTAATCAAATAAAATGTAACATGTCTGTAGAATGTGAT
GGTCAAAATTTAAAAGGAGAAAATTAATAAAAATTAATTGATGTTAATAATTAAAGAGTC
TTTGGTAGAGATATTGCGAACGTCGATCAAGAAAGAACATTTTCATAAAATAATATGCAA
GTAAAATTTCATTAAAAATCATAAGCCAAATCATTTACTAATCAAATTTATTTTGTTTTA
CAGAATAGTTGCAAAATTCAGTAAAGTCAGAATTATGCAAAACCTATGGGGTACACAAAG
ATAGAAAAGCAGAATTATATGTAAGTTCAAAATAAAGATGAAAATTAAATCTACGCTAAT
CATACTAAGAACAATATGTATGTTGAATATGATGGTTAAAATCAATAAAAACTTGCTAAT
CCCAACAGTTAGCGCGTTTATGCCAAAGAAACAACAATTTCTGACCAAGAAAGACTGCAA
CAATAAAATAATATTCAAGTAAAATTAATTCATTTTAATTCAAAAAATATTTTTTTTTAC
AAATTTAAATAATTTATTTATTTATTTAAAGAATAATTTCAAGTCTCAACAAAACTAGAA
CTTTGCAAAGCCACTTGGATATACTAAATTAGATAAGTAAAACGTTTAAAACAATAACCA
ATTAGAATAAAATAGCTAACAATAAAGTAACTGCTTCAATTAACTAAAACGTCACATGTC
TCTTGAATGCATCAATGGTGATGACAACCAAAATATAAAATGTGAGAGCAACTTCTATTC
TCGTAATAGTATGGCAAGCTAATAAATGTAAGATGAAAATTATCATGCGGCTTCAAATGG
ATTTTCCAACAACAACAACACCTATAAAGCTAATACTTGCAAAGCTTCTTACGATAAAGA
GAATTTCAATCAAATATCAACTGGATTTAGTGGATTAACTTAGTCAGTTCAATAAAATAT
AACTTTTAGATAAAAAAATGTGATGGATGTCGAAAACTCTCAACAATCTCATGCAACCAC
TTACAGGTCTTTGGAAAGAAAATAAGTAGTTGAATACACCTTCCCTAAAGACACACTTCA
AAAAGATCCTATTTACTAATACGCAAGGACAATTTTTGATTATCTACGTAGCAACGAAGT
AATAAATTATTTCTTTAAAACTATTTTATTCAAAAGTTTGTTTATTTTAGAATGAATTTT
TATATATTTTTGGTTTATTTATCAAAAGGAAGCGTATTGCGCTAAAGGGACTATGAACAA
AGTGTAAGATGAAATAACTGCTAGAATGAGAGCTATTATGGTAGACTGGATAGTTGATGT
GCATCTCAAATTTAAGCTCTTACCTGACACACTATATTTGACTATTAATTTGATCGACAG
ATATATTGAAAGAAAGTAAATTTCCAAAGATAGATTACAACTTCTAGGTGCTACTTCAAT
GTTCATAGCTTGTAAATTTGAAGAAATTTATCCACCTGAGATTAATGACTTTGTGTTTAT
ATGTGATAGTCTCTATACAAAGGAATAAATATTATAAATGGAGGGTGAATTAATCACAGC
AATTAATTTTGATTTAACTTACACCAGTCCTTTACGTTTTCTTAACAGATATAGTTACCT
GAATGAATCCACTGAAGTATAATACTATTGTGCACAATATCTTTTAGAGCTCTCTCTAAT
TGAGTATAAAATGACTGAGTATTCTTCATCAAACTAAGCTGCAAGTGCACTATATTTAGT
AAATAAAATATTTGACTAACCATGGAGTGAAGAGCTTCGCAACCAATCCCACTATGATTA
GTCTTCTCTTAAAAAATGCGCTAAAGATATGTACGCTCTTCTTTAAAAGGCAAATGAGTT
CTAATACAAGTATCAGATTTAGGTTGCAGAGTATGAAAATTAAAAATAACTACAGATGGC
TTAATTAAAACAATGGTATAACCTTGAAAAGTCTAGACTAGAATAAGAATAGAATTTTGT
CTAAGATCATCACGAATAATTAGAAATAGACTACGACCAAAAGAGAAAAGAAATAGAAGC
TAAATTCAAAGAAATCAAAGGCTAATTACTATGCAATAATAAAAACTTAGTAGCAATTAT
CCGTAAATTTTCTCTTGCTGAATTCAAAGAGCCTGCTAAATTTCTGTTTTGCCTAGAGTA
TCCTTTGCCCTGA