Identifiers and Description

Gene Model Identifier

TTHERM_00192000

Standard Name

CYC5 (CYClin)

Aliases

PreTt08850 | 15.m00561 | 3697.m00272

Description

Cyclin, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00192000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06131.29.997093137033517e-262cyclin domain-containing prote
in (854 aa)
OxytrichaContig16327.0.g532.999661265281073e-47Cyclin, N-terminal domain
DictyBaseDDB_G02855532.9998215087698487e-30cycL on chromosome: 4 position
3372094 to 3373198
WormBaseWBGene000008765.0013199114200274e-20locus:cyl-1 status:Confirmed
UniProt:G5EBX3 protein_id
:CAB01416.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64
  2. Ref:SUPR000108

Sequences

>TTHERM_00192000(coding)
ATGGCTCAAAAAATTTAAGAGTTAGAAGAATAGTTTTAATAATTTGAATAATCAATTGGA
ATTAACGATTAAAATTTTGCTAATAAATTCATCTTTTAGTAATTGAGGGAGAATTTGATT
AAGGCTTCCGCAGAATCGAATGATAAATTGCAGAAATTTTTAGATTAGGCTCATACAAAT
TTGTACTTGGAAATTAGTTCAAAGATTTAAGCCGATTTAGATGGATTCACTAGAGAAGAA
TAAAACATGCTTCATTTTTATGGCGCATCAATAATTTCTGATGCATGCTAATATCTTTAG
CTTCCAATTACAACTTGTATATCAGCCTAAACTATTTTCCACAGATTTTATACCAAGTGC
TCTTTCTTGAAGCATGATATCAGGGATGTAGCAATGGGATCAGTTTTTATAGCTGGTAAG
GCTTAAGAAACAATTAAAAAGCCAAGAGATTTAGCCTATGTCTTTGATCAAATTTTTAAA
ATTGAAGATGGTATACAACGTCCAGTTCCAATTTTAGATGATAAATCATTTAAATTTAAT
CATTTAAAATAAGTGGTTTAAGACATGGAAAGAGAGATTTTAAAAGAATTAGGCTTTGAG
TTATATCAAATTACATGGAATGAACAACCTCATAGATTAATGTACTTCTATATTAATTTA
TTTAAACCAAATACCAGTAATTAATCGAGTTCCTTTTAGAATTTGACTAGAACAGCATTC
AACTATTTGAATGATAGTTACAAGACAAACATCTGTATTTTCTTCCCTTTCTAGATGATA
GTAGCAAGCTGCATTTACCTAGCCTTTAGAAAGACAGGTACTGAAATGCCAAGAATTGCT
TGGTGGACAATTATGGAAACTTCTCTGAACAATCTTAAGCTAGGAGCGGGTAAAATCTAA
TATATTTATAATCAATTTAAATAACTTCCTAAATATGAGGACTGCTTCGAAATTCTTAAT
AAACTTGCAAAACAAAAGGAAATAGAGTTGAAAATCACTCTTAAATATCATGAATTTACA
GATAGATTAAACCAAAGTTCTGCATCTTAGAATCCTATGTTAGCTGTCCAAGAAGCTATC
GCCAAATCAAAATTAAGGGGATAAAATGGATTGGCTGCAGGAGCATCATCATCAGACAAG
TTGTTATCATCAGATTAGCTTGAAAAAAAAGAAAATTAAGATGAAACTGCAGGAGTTACT
AGTTTAAGAGATGTTACCAGTACTAAAAATGATAAGCATAGCAAATTTTCTACGGCTGGT
AGATCAGCATCAAGAGAAAGAGATAGACGTAAAAGGTCCAGAAGCAATTCCCACAAAAAA
TCCCATAAAAGAAGATCAAGTCGTAGTAGAAGTCGTAATCGTAATAGAGATCGTAAGGAT
AAAGATAAAAAGCATTCTTCTCGTCACAGTCGCAGCAGAGATCGTCGTGATAGAAGTAAT
TCCCATAAAGATAAAAAAAAAAGAAGTAAAAGTCGTGAACGTGAACGCGAACGTAGAAAA
GAAAAGTAAGAAGTCCAAAAGCCTACAAGTGCTGAGCGTTAATAAAACGATTAATAAAAG
TCTTAAGAGGAATAAAAAACCAACGGTAATGGTGCATCATCAAGTATAAAAACTACTTCT
GAAACACCAGATATTAAGTAAGATAAAACTTCACCTTTAAATTCTAAAAAAGATAAGAAT
TAAAGAGATCGTGAATCTGCATCAACAGTAAGGGATGTAAGAGAAGGTAGGGAAAAGGAA
AAGGACAGAAAAGAAAGAAAGAAGAGTAGAAGCCGTAGTAGAAGTCATCATAAAAAATCT
AAAAAGTATTATAACTCTCCTGATGATAGGGATAGTAAGAGAAAGCGCAGTAAAGATAGA
AAAAAAGACTATAAAAAATCAAGGAGCAACAGCAGAGAAAAATAGTCTAAATTTTCAGTT
CCTACTTCATCTACTCAATAGATGGAATCAATTGCAAAAATTACACCTTCTCCTCCCTTG
AAATAAGATAAATTTACTACAGTTCTAAATGAAAAAAGTAATGATTTTTCATCTGTATAA
AATAAAATACTTCCTTCTGATAATAAAAATATTCATTAAGAAAATCAAATAAATGGCAAT
CCAAGTATTATTGAAACAGCTGCTCCTGCTCCCAACTAAAAATTTATTTAAAAAACTGAT
TAAATTAAGCCTCAAGAATAAAATTCTTTATTAGATGGAAAGAAAACACTTGACATTATC
TAATAAATAAAATCTAAAATTTAATCAAAGGCTACTAATGAGGAAAGTTCGAATTAAAAA
ATATCAAGTTCTAATGTCACTTAAGAAACTAACCTAACATAGAAGGCTCAGACAAACCCA
ACCAAACCAACTTTAGATTTAAGCGCTAAATTGAGTGAAAAGTTTAAATAGTACGATAAC
AAACTGCCCTCTTCATCATCATCAACAACAACATCAACTACAACATCAACTACAACAGCA
ACAAAATTAGTAGCAGGAGCCAGTTAGCCATAGTTGTCTAAGTAATTGTCAAAAGAAAGT
ATGACTTCAAACGATGATGAAAATAATGACAACGATGACTATCTGATGAGATTGAAAATG
CTTCGTGAACAAAATAAATAAAAGGCTCAACAAGGAAACTAATGA


>TTHERM_00192000(protein)
MAQKIQELEEQFQQFEQSIGINDQNFANKFIFQQLRENLIKASAESNDKLQKFLDQAHTN
LYLEISSKIQADLDGFTREEQNMLHFYGASIISDACQYLQLPITTCISAQTIFHRFYTKC
SFLKHDIRDVAMGSVFIAGKAQETIKKPRDLAYVFDQIFKIEDGIQRPVPILDDKSFKFN
HLKQVVQDMEREILKELGFELYQITWNEQPHRLMYFYINLFKPNTSNQSSSFQNLTRTAF
NYLNDSYKTNICIFFPFQMIVASCIYLAFRKTGTEMPRIAWWTIMETSLNNLKLGAGKIQ
YIYNQFKQLPKYEDCFEILNKLAKQKEIELKITLKYHEFTDRLNQSSASQNPMLAVQEAI
AKSKLRGQNGLAAGASSSDKLLSSDQLEKKENQDETAGVTSLRDVTSTKNDKHSKFSTAG
RSASRERDRRKRSRSNSHKKSHKRRSSRSRSRNRNRDRKDKDKKHSSRHSRSRDRRDRSN
SHKDKKKRSKSRERERERRKEKQEVQKPTSAERQQNDQQKSQEEQKTNGNGASSSIKTTS
ETPDIKQDKTSPLNSKKDKNQRDRESASTVRDVREGREKEKDRKERKKSRSRSRSHHKKS
KKYYNSPDDRDSKRKRSKDRKKDYKKSRSNSREKQSKFSVPTSSTQQMESIAKITPSPPL
KQDKFTTVLNEKSNDFSSVQNKILPSDNKNIHQENQINGNPSIIETAAPAPNQKFIQKTD
QIKPQEQNSLLDGKKTLDIIQQIKSKIQSKATNEESSNQKISSSNVTQETNLTQKAQTNP
TKPTLDLSAKLSEKFKQYDNKLPSSSSSTTTSTTTSTTTATKLVAGASQPQLSKQLSKES
MTSNDDENNDNDDYLMRLKMLREQNKQKAQQGNQ


>TTHERM_00192000(gene)
ATGGCTCAAAAAATTTAAGAGTTAGAAGAATAGTTTTAATAATTTGAATAATCAATTGGA
ATTAACGATTAAAATTTTGCTAATAAATTCATCTTTTAGTAATTGAGGGAGAATTTGATT
AAGGCTTCCGCAGAATCGAATGATAAATTGCAGAAATTTTTAGATTAGGCTCATACAAAT
TTGTACTTGGAAATTAGTTCAAAGATTTAAGCCGATTTAGATGGATTCACTAGAGAAGAA
TAAAACATGCTTCATTTTTATGGCGCATCAATAATTTCTGATGCATGCTAATATCTTTAG
CTTCCAATTACAACTTGTATATCAGCCTAAACTATTTTCCACAGATTTTATACCAAGTAA
TTTATTTTATTTTGAATGCATTAGAAATATTTTTTAATTGATTCAAAACATTAAAAATAA
TAAATAATTTTTTTTTTTTCTATAAAAAGGTGCTCTTTCTTGAAGCATGATATCAGGGAT
GTAGCAATGGGATCAGTTTTTATAGCTGGTAAGGCTTAAGAAACAATTAAAAAGCCAAGA
GATTTAGCCTATGTCTTTGATCAAATTTTTAAAGTAAATTATCAGTTTATATTAGATTGC
TATCAGCAAAGGAGATTCCTTCAAGAATCAAATCAACCCTCCTAAATCAAACTTTTCAAT
AATTTTTTTAAAAAAACTTTGAAGGAAAAAAATTAGATCTTAGCTTATTTGCTTTATCTT
ATGAAAATAATTATTTTAATCATTTGAACTAATTAATAATATAATTATAGGGTAAATTTA
TTTTTATGATCTATCATCATCTTCATCATCTTGCTAAATTGAAAGTATTAATATATTAAA
CACCTTCCCTAAACACTTTCAATGAAAATGTGGCTGGTGTTAGTTAATAAGATTGAATTA
AAGATTAATTTGTTCATCAAAATACACAAACACTACCAATTATCATTATCACTATCAACC
AACAACATCAACGAAATAATCTATTTTGTTTGATTCCCTAGTTCCTAAAATTATATGAAA
ACTTCTTACTGAAGTGATAATAACAATAGATGAATTAAAATCCTTAATCTTATTTTTAAA
TACAATTATGTTAGGAATTTTTTAATTTCTCTTATTCAAAGCACAGGCCAATAAATGCTA
TTTTTAAGCAGAAATAGTAAGTTAATTCAGTTTTAGAGAAGCAAGAAAAGCTATGAAAAT
AATTGAATAAAAAAAGTCTTCCAAAAACAAAAATAAAATTATTTATTTCCTTCAAATAAA
AGATTTTTAATTAATTTTTAAAAAAAGCGCCCTTTTTAAATTTACTGAAAAACAAACTGT
CTCTATTCATGATAGCAAATCGATATAATTTAAAAAGTAAATTTCATGCTTTTTATTTTA
AAAAATAGATTGAAGATGGTATACAACGTCCAGTTCCAATTTTAGATGATAAATCATTTA
AATTTAATCATTTAAAATAAGTGGTTTAAGACATGGAAAGAGAGATTTTAAAAGAATTAG
GCTTTGAGTTATATCAAATTACATGGAATGAACAACCTCATAGATTAATGTACTTCTATA
TTAATTTATTTAAACCAAATACCAGTAATTAATCGAGTTCCTTTTAGAATTTGACTAGAA
CAGCATTCAACTATTTGAATGATAGTTACAAGACAAACATCTGTATTTTCTTCCCTTTCT
AGATGATAGTAGCAAGCTGCATTTACCTAGCCTTTAGAAAGACAGGTACTGAAATGCCAA
GAATTGCTTGGTGGACAATTATGGAAACTTCTCTGAACAATCTTAAGCTAGGAGCGGGTA
AAATCTAATATATTTATAATCAATTTAAATAACTTCCTAAATATGAGGACTGCTTCGAAA
TTCTTAATAAACTTGCAAAACAAAAGGAAATAGAGTTGAAAATCACTCTTAAATATCATG
AATTTACAGATAGATTAAACCAAAGTTCTGCATCTTAGAATCCTATGTTAGCTGTCCAAG
AAGCTATCGCCAAATCAAAATTAAGGGGATAAAATGGATTGGCTGCAGGAGCATCATCAT
CAGACAAGTTGTTATCATCAGATTAGCTTGAAAAAAAAGAAAATTAAGATGAAACTGCAG
GAGTTACTAGTTTAAGAGATGTTACCAGTACTAAAAATGATAAGCATAGCAAATTTTCTA
CGGCTGGTAGATCAGCATCAAGAGAAAGAGATAGACGTAAAAGGTCCAGAAGCAATTCCC
ACAAAAAATCCCATAAAAGAAGATCAAGTCGTAGTAGAAGTCGTAATCGTAATAGAGATC
GTAAGGATAAAGATAAAAAGCATTCTTCTCGTCACAGTCGCAGCAGAGATCGTCGTGATA
GAAGTAATTCCCATAAAGATAAAAAAAAAAGAAGTAAAAGTCGTGAACGTGAACGCGAAC
GTAGAAAAGAAAAGTAAGAAGTCCAAAAGCCTACAAGTGCTGAGCGTTAATAAAACGATT
AATAAAAGTCTTAAGAGGAATAAAAAACCAACGGTAATGGTGCATCATCAAGTATAAAAA
CTACTTCTGAAACACCAGATATTAAGTAAGATAAAACTTCACCTTTAAATTCTAAAAAAG
ATAAGAATTAAAGAGATCGTGAATCTGCATCAACAGTAAGGGATGTAAGAGAAGGTAGGG
AAAAGGAAAAGGACAGAAAAGAAAGAAAGAAGAGTAGAAGCCGTAGTAGAAGTCATCATA
AAAAATCTAAAAAGTATTATAACTCTCCTGATGATAGGGATAGTAAGAGAAAGCGCAGTA
AAGATAGAAAAAAAGACTATAAAAAATCAAGGAGCAACAGCAGAGAAAAATAGTCTAAAT
TTTCAGTTCCTACTTCATCTACTCAATAGATGGAATCAATTGCAAAAATTACACCTTCTC
CTCCCTTGAAATAAGATAAATTTACTACAGTTCTAAATGAAAAAAGTAATGATTTTTCAT
CTGTATAAAATAAAATACTTCCTTCTGATAATAAAAATATTCATTAAGAAAATCAAATAA
ATGGCAATCCAAGTATTATTGAAACAGCTGCTCCTGCTCCCAACTAAAAATTTATTTAAA
AGTAAGATTTGTTTCATAATTTATAAAATAATAGCAATTTAACTCTAATTAATAACATCA
AATTACTAATAATAAAAAGAACTGATTAAATTAAGCCTCAAGAATAAAATTCTTTATTAG
ATGGAAAGAAAACACTTGACATTATCTAATAAATAAAATCTAAAATTTAATCAAAGGCTA
CTAATGAGGAAAGTTCGAATTAAAAAATATCAAGTTCTAATGTCACTTAAGAAACTAACC
TAACATAGAAGGCTCAGACAAACCCAACCAAACCAACTTTAGATTTAAGCGCTAAATTGA
GTGAAAAGTTTAAATAGTACGATAACAAACTGCCCTCTTCATCATCATCAACAACAACAT
CAACTACAACATCAACTACAACAGCAACAAAATTAGTAGCAGGAGCCAGTTAGCCATAGT
TGTCTAAGTAATTGTCAAAAGAAAGTATGACTTCAAACGATGATGAAAATAATGACAACG
ATGACTATCTGATGAGATTGAAAATGCTTCGTAAATAATTTTTACATATTGTTTAGATAA
AATAGTGATAAAATTTAACTGTCTAAAAATTAGGTGAACAAAATAAATAAAAGGCTCAAC
AAGGAAACTAATGA