Identifiers and Description

Gene Model Identifier

TTHERM_01043080

Standard Name

CYC4 (CYClin)

Aliases

PreTt03241 | 208.m00034 | 3807.m00207

Description

Cyclin, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01043080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20150.12.9995941501461703e-129cyclin domain-containing prote
in (470 aa)
OxytrichaContig19422.0.g43.9990760533890984e-36Cyclin, N-terminal domain
DictyBaseDDB_G02754930.000000000029994712494008525cycB on chromosome: 2 position
6000211 to 6001649
SGDYGR109C0.0000000000599805963605737CLB6 B-type cyclin involved in
DNA replication during S phas
e; activates Cdc28p to promote
initiation of DNA synthesis;
functions in formation of mito
tic spindles along with Clb3p
and Clb4p; most abundant durin
g late G1
WormBaseWBGene000008650.0000000006000548789370351locus:cyb-1 G2/mitotic-speci
fic cyclin-B1 status:Confirm
ed UniProt:Q10653 protein_
id:CAA94384.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_01043080(coding)
ATGTTCTGGTAAAAATTAGACACTAACTAAAAGCCTGTTATGTAGTAGAATAACATCAAT
AAAGTACTTTAACTTGATAACTAAAATAAATCTAAGTTAAACGACTAGTAATTCAACTGC
GCTCAATAAAAATGCAGCCAACCCTAATTATATAATCTCTCAGTAAAAGCTTGTGTATCT
AATGAAATTTAATCATCTGAAAATGCTTCAACTGATGGCTCTTCCTGTTCATAAAACATG
AATTCTGCTGATTCTTAGTAATCTGGCATCTAAAGTTATGAATGGATCGAAAGTTCTTAA
ACTACTGCCCCTGTTGAAATCTCTGGTCAAAGTACACTCTAAAAGACTTAAAGCAACGAA
GAAACCTTCTTCCCAAGAGTTTTTTCTAACAATATGATGGATGTCTAAGAACCAACTGAA
TTTTTAAAAAGACACGCAATCACTGCAGCAATGAGAGCTAAGATGATTGATTGGATGATT
GAAGTTCTTAAGGCTTACAATTTCTCCGAAACTACTTTCTCCCTTTCCGTTGCCATCATG
GATGCTTACTTCGCAAATGTATAAAGAAGTTTATAAGTTGATGAGCTCCATGCTATTGGT
ATTGTTAGCATGTTCATTGCTTCAAAATATGAAGAAATTGTACCCTTTTCATTATAAAAG
CTTTATGAGAAGATTGGTCACGAAAAGATCAGTATGTAAGTATTAAAATAGACTGAGGCA
GAAATCTTGAATACCCTTAATTTCAATATTTCCTTCCCTACCTTAGATATCTTATCAAAT
TTAATGATTAAGTATCTTGATTCTCAAGACTTCTTTAGCAGCTACACATAATAATCCAAA
GAGTTCTTCAATTGCTTAAACGCATACATGTTCAAGCTCACCACATTGGATTATGAATAA
TTAATGAGTAAATACAACTATAAAACCCTCGCAGTATGTTCTGTCTTTGTTTCAATCTAA
GTCATGCAATAGTTCTTCCCTTACTTTGATTAATTCAAATATGTATTACCCTTCCTTGAT
TTACTTGGAATGACCTACGACCAAATCATATAGCCTGCCTAAAGAATACTTACTTTAGCT
AAAACATACGATAAGCATTTCAGTAGCCTTAAAAACCTTAAAAAATACAATTTAGAAGAG
ATAAATAGAAAAACTTCTCGTTGTTTCAAAATTTGA


>TTHERM_01043080(protein)
MFWQKLDTNQKPVMQQNNINKVLQLDNQNKSKLNDQQFNCAQQKCSQPQLYNLSVKACVS
NEIQSSENASTDGSSCSQNMNSADSQQSGIQSYEWIESSQTTAPVEISGQSTLQKTQSNE
ETFFPRVFSNNMMDVQEPTEFLKRHAITAAMRAKMIDWMIEVLKAYNFSETTFSLSVAIM
DAYFANVQRSLQVDELHAIGIVSMFIASKYEEIVPFSLQKLYEKIGHEKISMQVLKQTEA
EILNTLNFNISFPTLDILSNLMIKYLDSQDFFSSYTQQSKEFFNCLNAYMFKLTTLDYEQ
LMSKYNYKTLAVCSVFVSIQVMQQFFPYFDQFKYVLPFLDLLGMTYDQIIQPAQRILTLA
KTYDKHFSSLKNLKKYNLEEINRKTSRCFKI


>TTHERM_01043080(gene)
ATGTTCTGGTAAAAATTAGACACTAACTAAAAGCCTGTTATGTAGTAGAATAACATCAAT
AAAGTACTTTAACTTGATAACTAAAATAAATCTAAGTTAAACGACTAGTAATTCAACTGC
GCTCAATAAAAATGCAGCCAACCCTAATTATATAATCTCTCAGTAAAAGCTTGTGTATCT
AATGAAATTTAATCATCTGAAAATGCTTCAACTGATGGCTCTTCCTGTTCATAAAACATG
AATTCTGCTGATTCTTAGTAATCTGGCATCTAAAGTTATGAATGGATCGAAAGTTCTTAA
ACTACTGCCCCTGTTGAAATCTCTGGTCAAAGTACACTCTAAAAGACTTAAAGCAACGAA
GAAACCTTCTTCCCAAGAGTTTTTTCTAACAATATGATGGTATTTTCAAATTATTATAGC
AATTTATTAAATTAACTAAATATCTTTTTAATATTAAAGGATGTCTAAGAACCAACTGAA
TTTTTAAAAAGACACGCAATCACTGCAGCAATGAGAGCTAAGATGATTGATTGGATGATT
GAAGTTCTTAAGGCTTACAATTTCTCCGAAACTACTTTCTCCCTTTCCGTTGCCATCATG
GATGCTTACTTCGCAAATGTATAAAGGTAAATAAACAAATAGTTTTGGATTCATCTTAAA
ATATAATTTTAGTTTTTTTCACCTTGCTCTAATTAAATAAATAAATACTTTAAATAATGT
ATTTTAAATTTATAAAAATCAGAAATAATTTTAAAATTTTAATTTTAATTTTATTTATTA
ATTAATTTATTACACTCTAAAAACTTATTGAAATAGATCAATTTTTGAGATAATTAATTG
AATATAATTATTTAACAACAACTCCAAAAATTTATAATTGAGGTTAGTTCCTAAAATTTT
AATTTAAAAGGCAAGCAAAAAAAAATGCTAAAGATATATAATCTTTATAAGCTTGTTAGA
ATAATTAACTAGCAAACATTCAATCACAAATATTAATTAATAAATAAATAAGATTAATTC
ATATATAATTTAGAAAGAATTAATAGAATATTTTTATCTGATGATTTTCAGACTTTAATT
AGAGTATTATAGAAGAAAACTATTTTTTTTAATCCAATAAACTAAATTTATTTTCATTAA
AAATAGAAGTTTATAAGTTGATGAGCTCCATGCTATTGGTATTGTTAGCATGTTCATTGC
TTCAAAATATGAAGAAATTGTACCCTTTTCATTATAAAAGCTTTATGAGAAGATTGGTCA
CGAAAAGATCAGTATGTAAGTATTAAAATAGACTGAGGCAGAAATCTTGAATACCCTTAA
TTTCAATATTTCCTTCCCTACCTTAGATATCTTATCAAATTTAATGATTAAGTATCTTGA
TTCTCAAGACTTCTTTAGCAGCTACACATAATAATCCAAAGAGTTCTTCAATTGCTTAAA
CGCATACATGTTCAAGCTCACCACATTGGATTATGAATAATTAATGAGTAAATACAACTA
TAAAACCCTCGCAGTATGTTCTGTCTTTGTTTCAATCTAAGTCATGCAATAGTTCTTCCC
TTACTTTGATTAATTCAAATATGTATTACCCTTCCTTGATTTACTTGGAATGACCTACGA
CCAAATCATATAGCCTGCCTAAAGAATACTTACTTTAGCTAAAACATACGATAAGCATTT
CAGTAGCCTTAAAAACCTTAAAAAATACAATTTAGAAGAGATAAATAGAAAAACTTCTCG
TTGTTTCAAAATTTGA