Identifiers and Description

Gene Model Identifier

TTHERM_00535270

Standard Name

CYC34 (Cyclin 34)

Aliases

PreTt03112 | 69.m00154 | 3718.m00016

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00535270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11224.14.997699094967085e-82hypothetical protein (201 aa)
DictyBaseDDB_G02804251.9991095569230066e-20DDB_G0280425 on chromosome: 3
position 3332494 to 3333718
SGDYIL050W8.002082816694397e-20PCL7 Pho85p cyclin of the Pho8
0p subfamily, forms a function
al kinase complex with Pho85p
which phosphorylates Mmr1p and
is regulated by Pho81p; invol
ved in glycogen metabolism, ex
pression is cell-cycle regulat
ed
OxytrichaContig20637.0.g1100.0000000000005000841553255702Cyclin
WormBaseWBGene000226970.000009999254677478949locus:cyy-1 Uncharacterized
cyclin-like protein ZK353.1
status:Partially_confirmed U
niProt:P34624 protein_id:CCD
73200.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00535270(coding)
ATGCAAAGAAGAGAAATGACCGCTATGACTCAAAATAAATCTGAAACCCAAGAATCCGTC
AAATAGTGTGGTAACTAAAAGGATATCTTGAAGTCAGAAGAAATCATGAGTCAAAATCCC
ATGTTGGACAATACCTCTGATGGTGAAAAAGTTGAAAAATCAATCAACTTACAAGCCATA
GCCGAATATCTCGAGCAAATTGCTCGTTAATAGGATGCTGAATAAGCTGTTCCTCACCCA
ACATTCGCTGCTAAAAAATTGCCTCCCATCTCCATTATGGACTACTTAAAGAGACTCCAA
AAATTCACCGATTGCTCAAATGCTAATTTCGTATTAGCTTTGATTTATATCGAGAGACTC
CAAGAAAGTATGGGAGAGATTCTTTTGAATTCATACACCATCTTGAGATTAATTTTGGCC
TCTACTATCATCGCTATCAAATACAACTACGACTAAACCTTGAAGAACGACTACTACGCC
AAGATTGGAGGAGTCAAGAAGGAGGAACTTAACGAACTCGAAGCTGCTTTCTGCGAAATG
ATGGACTTCAGATTATACGTTAGTGACGAAACCTTTGAAAACTACGTTAACCAATTCTCT
TTCTGA


>TTHERM_00535270(protein)
MQRREMTAMTQNKSETQESVKQCGNQKDILKSEEIMSQNPMLDNTSDGEKVEKSINLQAI
AEYLEQIARQQDAEQAVPHPTFAAKKLPPISIMDYLKRLQKFTDCSNANFVLALIYIERL
QESMGEILLNSYTILRLILASTIIAIKYNYDQTLKNDYYAKIGGVKKEELNELEAAFCEM
MDFRLYVSDETFENYVNQFSF


>TTHERM_00535270(gene)
ATGCAAAGAAGAGAAATGACCGCTATGACTCAAAATAAATCTGAAACCCAAGAATCCGTC
AAATAGTGTGGTAACTAAAAGGATATCTTGAAGTCAGAAGAAATCATGAGTCAAAATCCC
ATGTTGGACAATACCTCTGATGGTGAAAAAGTTGAAAAATCAATCAACTTACAAGCCATA
GCCGAATATCTCGAGCAAATTGCTCGTTAATAGGATGCTGAATAAGCTGTTCCTCACCCA
ACATTCGCTGCTAAAAAATTGCCTCCCATCTCCATTATGGACTACTTAAAGAGACTCCAA
AAATTCACCGATTGCTCAAATGCTAATTTCGTATTAGCTTTGATTTATATCGAGAGACTC
CAAGAAAGTATGGGAGAGATTCTTTTGAATTCATACACCATCTTGAGGTAAAAGAGGATT
CATTCTGCAAAAAATCCACATATAACTCCTATATAAAATCAATTCGTTGCAAAAAATATT
TCCACACTATAAAAAAAAAATCAAAAAAATGCGCGAATTTTCCCTTCAAAATATGAAGGA
GGGGGTTAAAAGTGGTAGCCAACATAATCGAATGAAAAAGAGAAATATAACGGTCCAATT
CTCACTTGAAAATTGCAAAGAAACAAATTTTTTCTTAAATGCAATTCAAGATACGAAAAA
TAAGAGATGATGGGTAACAAAAAGCAAAGTCTTTATAAATGTTTACATCAATCACCTTCC
TTATTTATTTGAGAAAGAAATGAAACTCGAAACAAAACAAAAAAAATCAAATAATGAACG
AGCAGGACGTTCCTGTAATAGAAAATTACAATTTGATTTAAAACGATGTTTCAAATAAAA
GGATCGCTTTCCTTCTTCATGAAGATGGATATCACGAAAACCTTTCAAAATTTTTACTTT
ATTTTTAAATTAATATTTTTATGGAAAGATACGAATACTTTTGAGATAAAAAGATAGATA
TAATATTTCCCTTCAAATTATTAATTTTGTTTTCTTTTTTATTAGATTAATTTTGGCCTC
TACTATCATCGCTATCAAATACAACTACGACTAAACCTTGAAGAACGACTACTACGCCAA
GATTGGAGGAGTCAAGAAGGAGGAACTTAACGAACTCGAAGCTGCTTTCTGCGAAATGAT
GGACTTCAGATTATACGTTAGTGACGAAACCTTTGAAAACTACGTTAACCAATTCTCTTT
CTGA