Identifiers and Description

Gene Model Identifier

TTHERM_00294860

Standard Name

CYC33 (Cyclin 33)

Aliases

PreTt15596 | 27.m00256 | 3692.m00059

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00294860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08745.11.999382702437002e-145hypothetical protein (278 aa)
DictyBaseDDB_G02774810.000000000000004001928599951003DDB_G0277481 on chromosome: 2
position 7953876 to 7955136
SGDYIL050W0.000000019990673443141236PCL7 Pho85p cyclin of the Pho8
0p subfamily, forms a function
al kinase complex with Pho85p
which phosphorylates Mmr1p and
is regulated by Pho81p; invol
ved in glycogen metabolism, ex
pression is cell-cycle regulat
ed
OxytrichaContig20637.0.g1100.0000020007268868677913Cyclin

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00294860(coding)
ATGACTGATCTATATCATGGAAATTCACCTGAACACTTTTTGAGTACTTGTGGAAGCGAC
AATTTTGATTCTATTGTAGCTAACTCAATCTCAGATAAAAACTGCACCCTTAAAGCCAAG
CAAATGTCATAGAGCTCTTTGTCATCTGTCTCAACTTCATCATCTTCCTTATCACAATCT
TCAATTATTGCTTAAAAGCCTTTAAACGCTGCTAAATATTAGCAAATTATTGAACAATTT
GACAAGCTAGAGAACAGCAATAAATCTAAATCAAGTTCTAAAAGCTCTATTTCATCTTCT
TAAATTTCTTAAAAGAAGATTAATGTTATTAAATTGACTGATTGGGTAGTCAACGACCTT
TGGAAGGATGCCTTTGAGCTCTACTAATTGTAGAATGAAGACGCTGAATACCTTGAGAAT
TGCTCCTTTTATTTAGAAGAAAACAAGCGCATTAAAATCTCATTTGCTTCTTATGTTAAA
AGACTTAAAGAACTAACTGAATGTTCTGATAATTGTTTCATTCTTGCCTTGTTACTCTTC
GATAGACTAAACAAGAAGAAGAAATTAAACTATAGTCGCATCAATGTTCACAAACTTATG
GCCATATGCCTTTGGTTGAGTGTCAAGTTCTATGAAGACATCAATTTCACTGATGCTTAC
TATGCACAAAAGATTGCTGGTATTCCTCTTGAGGAGCTCATTTCTCTTTAATTCGAACTT
CTCGAGCTTTTGAATTATAGATTATTCATTTCACCTCAAAGATTCAACCACTTCATGAAG
CTCATCAACTCTCTCATTCAATCTGGAGCTGTTAATGCTTGA


>TTHERM_00294860(protein)
MTDLYHGNSPEHFLSTCGSDNFDSIVANSISDKNCTLKAKQMSQSSLSSVSTSSSSLSQS
SIIAQKPLNAAKYQQIIEQFDKLENSNKSKSSSKSSISSSQISQKKINVIKLTDWVVNDL
WKDAFELYQLQNEDAEYLENCSFYLEENKRIKISFASYVKRLKELTECSDNCFILALLLF
DRLNKKKKLNYSRINVHKLMAICLWLSVKFYEDINFTDAYYAQKIAGIPLEELISLQFEL
LELLNYRLFISPQRFNHFMKLINSLIQSGAVNA


>TTHERM_00294860(gene)
ATGACTGATCTATATCATGGAAATTCACCTGAACACTTTTTGAGTACTTGTGGAAGCGAC
AATTTTGATTCTATTGTAGCTAACTCAATCTCAGATAAAAACTGCACCCTTAAAGCCAAG
CAAATGTCATAGAGCTCTTTGTCATCTGTCTCAACTTCATCATCTTCCTTATCACAATCT
TCAATTATTGCTTAAAAGCCTTTAAACGCTGCTAAATATTAGCAAATTATTGAACAATTT
GACAAGCTAGAGAACAGCAATAAATCTAAATCAAGTTCTAAAAGCTCTATTTCATCTTCT
TAAATTTCTTAAAAGAAGATTAATGTTATTAAATTGACTGATTGGGTAGTCAACGACCTT
TGGAAGGATGCCTTTGAGCTCTACTAATTGTAGAATGAAGACGCTGAATACCTTGAGAAT
TGCTCCTTTTATTTAGAAGAAAACAAGCGCATTAAAATCTCATTTGCTTCTTATGTTAAA
AGACTTAAAGAACTAACTGAATGTTCTGATAATTGTTTCATTCTTGCCTTGTTACTCTTC
GATAGACTAAACAAGAAGAAGAAATTAAACTATAGTCGCATCAATGTTCACAAGTAATTT
ATTATTTTAATAAAATTTCATTTTAGTTTTTAAAATTTTACACATCTATGCTTTTCCATT
TATTTTTATTGAGGATAAATTTCATACGATCTGATTAGAACTAATAAAATATTCTTCCTG
GTTGATTTTTGCTACTGAAGCTCATTCAAGCTAAATAGAAATTTTAAGAGATGAAAAAAA
TATTAAATTCTGGACTTTAAAATTAAATGAATTTCGAATGAGAAGGAGTGGAAGAGAGAA
TAAATAAACTCGTGACTGAGCAAGGAAGGAATGAGGAGAAATAGGCGAAATTAACTGCAC
ACTCGAAAAAGAAATTTTCTGTTAATTGAGAGGAGTTATTAATTGATTGATTAGTTAGTT
AGTTAGTTAGTTATAGAACTTAAAGTAAGTAGATGTTTCAAAAAAAATCAAAGAGAGTGC
ATCTGCAAATTTTTGAAAAACCCCCCTTACTAAAAAAATGGATACTTTTATAATTTCCAC
TCAATTAATCAATATTTCTCCGCTAAAAAATAAAAACGTATGATTGATTGATTATTCTTA
TATAAAAGAGAGCTATCTCTCACTCTATTTTTCGCTACATCCTTCTATTCCAATATCAAA
AACTTATAAAAATAAATAGATTATCCCTCTGTATTTAACCTAAAAAATTAATTATAGAGC
CATTAACTTCACAATAAAAGCATAGATAACAAATATACAAATAAACAAACAATTCTATTT
TTCTTAACCATTAAATTAATCAATTTCTTATTATTAATATAGACTTATGGCCATATGCCT
TTGGTTGAGTGTCAAGTTCTATGAAGACATCAATTTCACTGATGCTTACTATGCACAAAA
GATTGCTGGTATTCCTCTTGAGGAGCTCATTTCTCTTTAATTCGAACTTCTCGAGCTTTT
GAATTATAGATTATTCATTTCACCTCAAAGATTCAACCACTTCATGAAGCTCATCAACTC
TCTCATTCAATCTGGAGCTGTTAATGCTTGA