Identifiers and Description

Gene Model Identifier

TTHERM_00049420

Standard Name

CYC32 (CYClin 32)

Aliases

PreTt11321 | 3.m01909 | 3824.m03079

Description

amine-terminal domain cyclin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00049420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01619.13.0005855096961235e-80hypothetical protein (243 aa)
DictyBaseDDB_G02804250.000000000000001999258566166494DDB_G0280425 on chromosome: 3
position 3332494 to 3333718
OxytrichaContig20637.0.g1100.000000000040005666873964816Cyclin
SGDYOL001W0.00000000009998509410508463PHO80 Cyclin, interacts with c
yclin-dependent kinase Pho85p;
regulates the response to nut
rient levels and environmental
conditions, including the res
ponse to phosphate limitation
and stress-dependent calcium s
ignaling

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00049420(coding)
ATGAGCACTTAGGGTTCTTTTTCATAAAATTGCTCCGAATTTTACTCACCTGCTACTGAA
AATAAAGAAGCTGGTGCTGAACAAGAATTGCAATGTTCTGCTGAAGACAATCAAGAAATC
TTTCTTTGGACATAAAAAGTCTCTCATATTTTGCAAGAAATTATTAAAGTCTAGCAAATC
TTGGATAAAAACAAACTCAGAAGCTTCCAAAATAGTTGTTTTAACAACAGCTGCATTCCT
TAAGTTTCACTTAGCGACTACATGTACAAAATCATGACTGAAGCTAGACTTGAAATTGAT
ATTTGCATAATCAGTCTATTCTACATTGATAGATTAACTTCTTGTCAGCCTAATTTCAGA
ATTAACTAATTCAATTGCCACAGATTAATTTTGACTTCTATGATGGTTGCTTCCAAGATG
CACTAAGACATACAAAGCTACTTCTAAGTTGTCAAGCTCTTTTCATTAATCGGAGGTGTA
TGTGAGAAAGAACTCTACTTGATGGAGTAGACATTATTAGATCTCCTTAATTACCAATTA
TTCATCTCAGAAGATGACTACACCAGATACAAAAACTAACTCACTTGTTTCTAGCTTTGA


>TTHERM_00049420(protein)
MSTQGSFSQNCSEFYSPATENKEAGAEQELQCSAEDNQEIFLWTQKVSHILQEIIKVQQI
LDKNKLRSFQNSCFNNSCIPQVSLSDYMYKIMTEARLEIDICIISLFYIDRLTSCQPNFR
INQFNCHRLILTSMMVASKMHQDIQSYFQVVKLFSLIGGVCEKELYLMEQTLLDLLNYQL
FISEDDYTRYKNQLTCFQL


>TTHERM_00049420(gene)
ATGAGCACTTAGGGTTCTTTTTCATAAAATTGCTCCGAATTTTACTCACCTGCTACTGAA
AATAAAGAAGCTGGTGTAAGAATTTGTTAAAAAATATTCATTTTTTATTTAAATAGACCT
TTTAATTTATACATTAGATTTGGATTGTTTTTAGTGTTTAATAAATAAATAAATTATTAA
ATTCAGTTCAAAAGTGTAAAATCACAACAATAATTTATCACTTTATTTGCTTTTTATTTA
TTGAAAATGCATGTTTTCTATGTTAAAAATACTCATTTGAGATCTAATTCTAAATTATCC
AAATTAGGCTGAACAAGAATTGCAATGTTCTGCTGAAGACAATCAAGAAATCTTTCTTTG
GACATAAAAAGTCTCTCATATTTTGCAAGAAATTATTAAAGTCTAGCAAATCTTGGATAA
AAACAAACTCAGAAGCTTCCAAAATAGTTGTTTTAACAACAGCTGCATTCCTTAAGTTTC
ACTTAGCGACTACATGTACAAAATCATGACTGAAGCTAGACTTGAAATTGATATTTGCAT
AATCAGTCTATTCTACATTGATAGATTAACTTCTTGTCAGCCTAATTTCAGAATTAACTA
ATTCAATTGCCACAGGTAATTAGTTTCTACTTTTTTTTATGGTTTTTTAACTTTTTTGCA
GGGCTATAATCACGTTAGTATTAATCCTTTTGAATTTATTAAAATTCTACTCGCCTTTAG
CATAAAATGTCACATAAATTTTGCTTATTTTACTAAGAAGTAAAGGCGTTGAAATAATAT
CTGTGTTTTCTCTACCTCTTTCTTTTTAAATTGCAAAAGATGATAAGATAATGAAAAAAA
AGAAAAAAAAAATAATATAAGGGCGCACACATAATTTTTTTTTTTAATTAATCAAATTCT
GTCTTTAGTATCCCCACCCTAACTTAAATAAGCTTATCTAGAAAAAGGTTGTATTAAAAA
CTAGAATGAAATATTCACAATTCATGATAAATTTTAAATATTTGATCAAAAAAAGTTATA
CTGGTATTACTCATACCAGCAATTTTAAAAGAGCGTAAAATACATACTGACATATTAAGA
TAAGAATATTTTGCATTTTATTTAAGTTTTCCTTTTTTTTATTATTCTTTATCAATCATT
CTACTTATTTATCTATAAATTTTACAAATCGGATTCAATTTTATCATGAATAAAATTAAT
AAGCGATTTACATAAAATTTCATTTGTTTCTTCAAATCAAGTAAACATGCCCACCCTACT
TTGAGTACTAGAAAAGAAAAAAAAAATAGAAATTAAAATTTTAGCTGAACTCATTAGCTA
CAATGAAAAAAGATAGAGCTTTCTTTATTTTTTAAAGAGATTGCTTTATGTAATTTTAAG
TAAATAAGAGAAGAGGAAAGGAAAATTTAATTTAATTATAATTTAATTGGTCCCCCACCA
TGTTATTTATTATAATTATTATTCATCATTCTAAAGCCTAAAAATTTAAGCTTTTACGTA
CTTATATTATTAATCGAATGCCACAAAGTCATATGGCTTAAATTATCCACTGACATTAAA
TAAATAAGCTATAGATTGATCGATAGAAATAGCAAGATTAGCAAATAAATGAGTAGCATA
TAAATAAATGTCTGCCATAATTAATTTATTTTTCTATCTTAAATGTGTCTATCCTGATAT
CAAATTTACTAGAATTATCAAATATATATATATGCCCAATAAAATTTAAACCCAAATCAG
TTTAACTGAAAATTTAATTGATTTCAATTTAAAAATAAATAGATTAATTTTGACTTCTAT
GATGGTTGCTTCCAAGATGCACTAAGACATACAAAGCTACTTCTAAGTTGTCAAGCTCTT
TTCATTAATCGGAGGTGTATGTGAGAAAGAACTCTACTTGATGGAGTAGACATTATTAGA
TCTCCTTAATTACCAATTATTCATCTCAGAAGATGACTACACCAGATACAAAAACTAACT
CACTTGTTTCTAGCTTTGA