Identifiers and Description

Gene Model Identifier

TTHERM_00049420

Standard Name

CYC32 (CYClin 32)

Aliases

PreTt11321 | 3.m01909 | 3824.m03079

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00049420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01619.13.0005855096961235e-80hypothetical protein (243 aa)
DictyBaseDDB_G02804250.000000000000001999258566166494DDB_G0280425 on chromosome: 3
position 3332494 to 3333718
OxytrichaContig20637.0.g1100.000000000040005666873964816Cyclin
SGDYOL001W0.00000000009998509410508463PHO80 Cyclin, interacts with c
yclin-dependent kinase Pho85p;
regulates the response to nut
rient levels and environmental
conditions, including the res
ponse to phosphate limitation
and stress-dependent calcium s
ignaling

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00049420(coding)
ATGCACGGTATTATTCTTATTGAACAAGAAGAATCTGCTCATAATTGCTGCTATGAATTG
GAACTTAAATTGGAATCTCATTCAGGTGAATCCTCAAATATGAGCACTTAGGGTTCTTTT
TCATAAAATTGCTCCGAATTTTACTCACCTGCTACTGAAAATAAAGAAGCTGGTGCTGAA
CAAGAATTGCAATGTTCTGCTGAAGACAATCAAGAAATCTTTCTTTGGACATAAAAAGTC
TCTCATATTTTGCAAGAAATTATTAAAGTCTAGCAAATCTTGGATAAAAACAAACTCAGA
AGCTTCCAAAATAGTTGTTTTAACAACAGCTGCATTCCTTAAGTTTCACTTAGCGACTAC
ATGTACAAAATCATGACTGAAGCTAGACTTGAAATTGATATTTGCATAATCAGTCTATTC
TACATTGATAGATTAACTTCTTGTCAGCCTAATTTCAGAATTAACTAATTCAATTGCCAC
AGATTAATTTTGACTTCTATGATGGTTGCTTCCAAGATGCACTAAGACATACAAAGCTAC
TTCTAAGTTGTCAAGCTCTTTTCATTAATCGGAGGTGTATGTGAGAAAGAACTCTACTTG
ATGGAGTAGACATTATTAGATCTCCTTAATTACCAATTATTCATCTCAGAAGATGACTAC
ACCAGATACAAAAACTAACTCACTTGTTTCTAGCTTTGA


>TTHERM_00049420(protein)
MHGIILIEQEESAHNCCYELELKLESHSGESSNMSTQGSFSQNCSEFYSPATENKEAGAE
QELQCSAEDNQEIFLWTQKVSHILQEIIKVQQILDKNKLRSFQNSCFNNSCIPQVSLSDY
MYKIMTEARLEIDICIISLFYIDRLTSCQPNFRINQFNCHRLILTSMMVASKMHQDIQSY
FQVVKLFSLIGGVCEKELYLMEQTLLDLLNYQLFISEDDYTRYKNQLTCFQL


>TTHERM_00049420(gene)
ATGCACGGTATTATTCTTATTGAACAAGAAGAATCTGCTCATAATTGCTGCTATGAATTG
GAACTTAAATTGGAATCTCATTCAGGTGAATCCTCAAATATGAGCACTTAGGGTTCTTTT
TCATAAAATTGCTCCGAATTTTACTCACCTGCTACTGAAAATAAAGAAGCTGGTGTAAGA
ATTTGTTAAAAAATATTCATTTTTTATTTAAATAGACCTTTTAATTTATACATTAGATTT
GGATTGTTTTTAGTGTTTAATAAATAAATAAATTATTAAATTCAGTTCAAAAGTGTAAAA
TCACAACAATAATTTATCACTTTATTTGCTTTTTATTTATTGAAAATGCATGTTTTCTAT
GTTAAAAATACTCATTTGAGATCTAATTCTAAATTATCCAAATTAGGCTGAACAAGAATT
GCAATGTTCTGCTGAAGACAATCAAGAAATCTTTCTTTGGACATAAAAAGTCTCTCATAT
TTTGCAAGAAATTATTAAAGTCTAGCAAATCTTGGATAAAAACAAACTCAGAAGCTTCCA
AAATAGTTGTTTTAACAACAGCTGCATTCCTTAAGTTTCACTTAGCGACTACATGTACAA
AATCATGACTGAAGCTAGACTTGAAATTGATATTTGCATAATCAGTCTATTCTACATTGA
TAGATTAACTTCTTGTCAGCCTAATTTCAGAATTAACTAATTCAATTGCCACAGGTAATT
AGTTTCTACTTTTTTTTATGGTTTTTTAACTTTTTTGCAGGGCTATAATCACGTTAGTAT
TAATCCTTTTGAATTTATTAAAATTCTACTCGCCTTTAGCATAAAATGTCACATAAATTT
TGCTTATTTTACTAAGAAGTAAAGGCGTTGAAATAATATCTGTGTTTTCTCTACCTCTTT
CTTTTTAAATTGCAAAAGATGATAAGATAATGAAAAAAAAGAAAAAAAAAAATAATATAA
GGGCGCACACATAATTTTTTTTTTTAATTAATCAAATTCTGTCTTTAGTATCCCCACCCT
AACTTAAATAAGCTTATCTAGAAAAAGGTTGTATTAAAAACTAGAATGAAATATTCACAA
TTCATGATAAATTTTAAATATTTGATCAAAAAAAGTTATACTGGTATTACTCATACCAGC
AATTTTAAAAGAGCGTAAAATACATACTGACATATTAAGATAAGAATATTTTGCATTTTA
TTTAAGTTTTCCTTTTTTTTATTATTCTTTATCAATCATTCTACTTATTTATCTATAAAT
TTTACAAATCGGATTCAATTTTATCATGAATAAAATTAATAAGCGATTTACATAAAATTT
CATTTGTTTCTTCAAATCAAGTAAACATGCCCACCCTACTTTGAGTACTAGAAAAGAAAA
AAAAAATAGAAATTAAAATTTTAGCTGAACTCATTAGCTACAATGAAAAAAGATAGAGCT
TTCTTTATTTTTTAAAGAGATTGCTTTATGTAATTTTAAGTAAATAAGAGAAGAGGAAAG
GAAAATTTAATTTAATTATAATTTAATTGGTCCCCCACCATGTTATTTATTATAATTATT
ATTCATCATTCTAAAGCCTAAAAATTTAAGCTTTTACGTACTTATATTATTAATCGAATG
CCACAAAGTCATATGGCTTAAATTATCCACTGACATTAAATAAATAAGCTATAGATTGAT
CGATAGAAATAGCAAGATTAGCAAATAAATGAGTAGCATATAAATAAATGTCTGCCATAA
TTAATTTATTTTTCTATCTTAAATGTGTCTATCCTGATATCAAATTTACTAGAATTATCA
AATATATATATATGCCCAATAAAATTTAAACCCAAATCAGTTTAACTGAAAATTTAATTG
ATTTCAATTTAAAAATAAATAGATTAATTTTGACTTCTATGATGGTTGCTTCCAAGATGC
ACTAAGACATACAAAGCTACTTCTAAGTTGTCAAGCTCTTTTCATTAATCGGAGGTGTAT
GTGAGAAAGAACTCTACTTGATGGAGTAGACATTATTAGATCTCCTTAATTACCAATTAT
TCATCTCAGAAGATGACTACACCAGATACAAAAACTAACTCACTTGTTTCTAGCTTTGA