Identifiers and Description

Gene Model Identifier

TTHERM_00013060

Standard Name

CYC31 (CYClin 31)

Aliases

PreTt11813 | 1.m00861

Description

amine-terminal domain cyclin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00013060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02742.16.997420649987812e-71hypothetical protein (203 aa)
DictyBaseDDB_G02774810.0000899730839127287DDB_G0277481 on chromosome: 2
position 7953876 to 7955136
OxytrichaContig14539.0.g240.0000899730839127287Cyclin
SGDYER059W0.0009001042212099794PCL6 Pho85p cyclin of the Pho8
0p subfamily; forms the major
Glc8p kinase together with Pcl
7p and Pho85p; involved in the
control of glycogen storage b
y Pho85p; stabilized by Elongi
n C binding

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00013060(coding)
ATGCATTACATTCATTCATTCATTTCTCATACTTTATGTTAACAAATATAGTTATCCACT
TGTTCAGCTCCAAATTTATCCTTCAGTTCTTAATTTCAAAGAAAAAGACCAAAAGTGAAG
AACCTCACAATATGCAAGATCTCCGCAATCCTTGAGAAGATTCAGGAAAATTCCTCTGCG
ATTCCACATTACAACTTTTAGAAACACAAGATGATTGTATTTGACTTGGAAGAAGATTTA
CAAAAATTAAAATTAACCTAATAAGATATATACACATAGAATAATTTAGTCTCTATTAAA
GAATTTCTATACAAAATATAAAGTAATTTGAAATGCCCAGATGAGTATTTCGTAGCAGCA
TTTTTGCTCATTTTAAAGTATTTGAGCCTTTCTTCAATTTAATTCACAGAAAACAACTGC
TAAAGATTGATTGCCTGCGCCATTATGCTTATAGAAAAATAATATAGTGATTATATATTA
TCACTCTACGCCTACTCTAGAGGAGTAAACATACCTGTTAAAGATTTATAAGAAATGGAA
TTATAATTTTTGTCTACAATAAACTGGGAAATTAATATTAAAGAAGAAGAATTTCAAGCT
TTTTAAGAGTATTTCAACACAATAAGCGCATGA


>TTHERM_00013060(protein)
MHYIHSFISHTLCQQIQLSTCSAPNLSFSSQFQRKRPKVKNLTICKISAILEKIQENSSA
IPHYNFQKHKMIVFDLEEDLQKLKLTQQDIYTQNNLVSIKEFLYKIQSNLKCPDEYFVAA
FLLILKYLSLSSIQFTENNCQRLIACAIMLIEKQYSDYILSLYAYSRGVNIPVKDLQEME
LQFLSTINWEINIKEEEFQAFQEYFNTISA


>TTHERM_00013060(gene)
ATGTTTAGATTGGATTCGGTATATAAGTTTGGACAATGGCTATTTAGTTAGTTAATATAG
ATAATTTTTGAAGATATGTTATGTTTTTGTATGTTTATTTATATGTGTGAAAATAGATAT
TATAAATAATAAGTACTAGATAATGTTAAAAATAACTGAGAAAAGGCTAGAGAAAAGATT
GAAAAAACCAATAATTTAAAAATAGGGAAATAAAAAAATAAATAAAAAATTATTAAAAAA
AAAAACAAAAAAGCAAACAAAAAAATAATAAAAAAGGAAAAAGAGCCTAAATATTTTACA
TTGAATTTAATTAATTCTTTTAGTTAAAAAATTAAAGCAAAAAATTAAGATAAATATTTT
TCTTCTTCTTTCAACTGCATAATTAAATCTGCAAATGAAAACATATGTACTTACTAATCA
ATTAATTAATTTACTTATTTCAAATTTATTATTCTTAATATTAAACAAATAATCAAACAA
ATTATACATAATTTGATTATTCTACATATGCATTACATTCATTCATTCATTTCTCATACT
TTATGTTAACAAATATAGTTATCCACTTGTTCAGCTCCAAATTTATCCTTCAGTTCTTAA
TTTCAAAGAAAAGTAAATCATTGATCAGAAAATATTTATTTTATTTCTGATTGTTTGTTG
CATTTGATTCTTTTCACTGCAACTTATAATCATCATTCATTCATTAATTCATTATCATTC
ATTTTTCATTTTTTAAATTATTCTCTCATTTAATTCAATAGAGACCAAAAGTGAAGAACC
TCACAATATGCAAGATCTCCGCAATCCTTGAGAAGATTCAGGAAAATTCCTCTGCGATTC
CACATTACAACTTTTAGAAACACAAGATGATTGTATTTGACTTGGAAGAAGATTTACAAA
AATTAAAATTAACCTAATAAGATATATACACATAGAATAATTTAGTCTCTATTAAAGAAT
TTCTATACAAAATATAAAGTAATTTGAAATGCCCAGATGAGTATTTCGTAGCAGCATTTT
TGCTCATTTTAAAGTATTTGAGCCTTTCTTCAATTTAATTCACAGAAAACAACTGCTAAA
GGTACTTTTTACACATTTATCTTAATTTTTTATGCAACATAAATCATAGATCAGTTATAT
AAAAACAAAAATAGTTAATTCATACTCAAATAAATTCTTCTTTTAGAAGGCATTTTGTCT
AAAGAAGTCTGCAATTTTACAACTAAAAAGAATAATCAATATTTTATTTATTGACTTCTT
TCTTTCTTTCTTAATTTCTCTGCTGAGTGTCTTTAATGAATGCACATAATAGATGCTTTC
ATAGAAATTTTATAATAGGATCTAAACAACCAGCTTTCCAAAACTAACCAAATAATAAAC
ACACAAACAAACAATCAAGCAAACAAACAAATAAAGTTATAACTAACTTATTGTATGCAG
ATACAAAATTTTTTAACCAGCAAATTGGTTTGTTTGTTTGTTTGTGATTTATTTACTCAT
TTGCTATAGTTTTTACACACGAAATTATCAAATTAAGTAATAATTCATGCTTCCAAATAG
ATTTCTAATTTACTATTAAAAAATAATACTAAAAATTTTCACTTCGCCGTACTCATATAG
CGAGTCACTTTTCTTTGTTATGTCATTAATTAAAAACAGACATATGATTATTGCGGCATA
ACAATTTCTATAAGTTATTTTACAACTTTAACACGACGTTTACAACTAAATAAATCTTAA
ATAGAAACAATCAATTAAATATATTATTTTTAAATTTTAGCATGAAAACTATTTTTAAAT
ACTTCCTCTATTACGAAGAAAAAGTTGCTTTACTTTTTAATTTTTCTTCTTCTGATTTGA
TTGTTGTGAGTGCTGAACTAGTCTTAAAAATTATAAACAGATATATTATTAAAGATTAAT
AAATATTAATAGATTGATTGATTGATATATACTTTGATTAATTTAAAAATTATAAATAGA
AAAACAAATTTTCAAAAAATTAAGCTAAGCAAATAAGATTTTACAACTTAATACTAATTC
AAATAAGTCCCCCACATAAAATAGCCAAGCAATTTGTTCATTTATAATTACTACTATAGA
TGATTTATAATTTTTATCATCAATATTAAATATCACTTCAGTTAAAAGCCAACAAAATTA
AACATAATAACTCAGCACATTTATAAATACCTACATAGAAATTAATATTTACTAAAAATT
TCATGTAACACGCATAATTGTAAAGGATATTGATTACTCTCATAAAATTATTGGTGAAAT
CAAAAACTATAAAATTGATTAGATTTCTAATTAAAAGAATTTATTTGCATACAAATTGAT
ATTCTATTTCAAATAATTTTACTAATAGAATTTTTTATTTAAAATAGATTGATTGCCTGC
GCCATTATGCTTATAGAAAAATAATATAGTGATTATATATTATCACTCTACGCCTACTCT
AGAGGAGTAAACATACCTGTTAAAGATTTATAAGAAATGGAATTATAATTTTTGTCTACA
ATAAACTGGGAAATTAATATTAAAGAAGAAGAATTTCAAGCTTTTTAAGAGTATTTCAAC
ACAATAAGCGCATGA