Identifiers and Description

Gene Model Identifier

TTHERM_00013060

Standard Name

CYC31 (Cyclin 31)

Aliases

PreTt11813 | 1.m00861

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00013060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02742.16.997420649987812e-71hypothetical protein (203 aa)
DictyBaseDDB_G02774810.0000899730839127287DDB_G0277481 on chromosome: 2
position 7953876 to 7955136
OxytrichaContig14539.0.g240.0000899730839127287Cyclin
SGDYER059W0.0009001042212099794PCL6 Pho85p cyclin of the Pho8
0p subfamily; forms the major
Glc8p kinase together with Pcl
7p and Pho85p; involved in the
control of glycogen storage b
y Pho85p; stabilized by Elongi
n C binding

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00013060(coding)
ATGTTAAAAATAACTGAGAAAAGGCTAGAGAAAAGATTGAAAAAACCAATAATTTAAAAA
TAGGGAAATAAAAAAATAAATAAAAAATTATTAAAAAAAAAAAACAAAAAAGCAAACAAA
AAAATAATAAAAAAGGAAAAAGAGCCTAAATATTTTACATTGAATTTAATTAATTCTTTT
AGTTAAAAAATTAAAGCAAAAAATTAAGATAAATATTTTTCTTCTTCTTTCAACTGCATA
ATTAAATCTGCAAATGAAAACATATGTACTTACTAATCAATTAATTAATTTACTTATTTC
AAATTTATTATTCTTAATATTAAACAAATAATCAAACAAATTATACATAATTTGATTATT
CTACATATGCATTACATTCATTCATTCATTTCTCATACTTTATGTTAACAAATATAGTTA
TCCACTTGTTCAGCTCCAAATTTATCCTTCAGTTCTTAATTTCAAAGAAAAAGACCAAAA
GTGAAGAACCTCACAATATGCAAGATCTCCGCAATCCTTGAGAAGATTCAGGAAAATTCC
TCTGCGATTCCACATTACAACTTTTAGAAACACAAGATGATTGTATTTGACTTGGAAGAA
GATTTACAAAAATTAAAATTAACCTAATAAGATATATACACATAGAATAATTTAGTCTCT
ATTAAAGAATTTCTATACAAAATATAAAGTAATTTGAAATGCCCAGATGAGTATTTCGTA
GCAGCATTTTTGCTCATTTTAAAGTATTTGAGCCTTTCTTCAATTTAATTCACAGAAAAC
AACTGCTAAAGATTGATTGCCTGCGCCATTATGCTTATAGAAAAATAATATAGTGATTAT
ATATTATCACTCTACGCCTACTCTAGAGGAGTAAACATACCTGTTAAAGATTTATAAGAA
ATGGAATTATAATTTTTGTCTACAATAAACTGGGAAATTAATATTAAAGAAGAAGAATTT
CAAGCTTTTTAAGAGTATTTCAACACAATAAGCGCATGA


>TTHERM_00013060(protein)
MLKITEKRLEKRLKKPIIQKQGNKKINKKLLKKKNKKANKKIIKKEKEPKYFTLNLINSF
SQKIKAKNQDKYFSSSFNCIIKSANENICTYQSINQFTYFKFIILNIKQIIKQIIHNLII
LHMHYIHSFISHTLCQQIQLSTCSAPNLSFSSQFQRKRPKVKNLTICKISAILEKIQENS
SAIPHYNFQKHKMIVFDLEEDLQKLKLTQQDIYTQNNLVSIKEFLYKIQSNLKCPDEYFV
AAFLLILKYLSLSSIQFTENNCQRLIACAIMLIEKQYSDYILSLYAYSRGVNIPVKDLQE
MELQFLSTINWEINIKEEEFQAFQEYFNTISA


>TTHERM_00013060(gene)
ATGTTAAAAATAACTGAGAAAAGGCTAGAGAAAAGATTGAAAAAACCAATAATTTAAAAA
TAGGGAAATAAAAAAATAAATAAAAAATTATTAAAAAAAAAAAACAAAAAAGCAAACAAA
AAAATAATAAAAAAGGAAAAAGAGCCTAAATATTTTACATTGAATTTAATTAATTCTTTT
AGTTAAAAAATTAAAGCAAAAAATTAAGATAAATATTTTTCTTCTTCTTTCAACTGCATA
ATTAAATCTGCAAATGAAAACATATGTACTTACTAATCAATTAATTAATTTACTTATTTC
AAATTTATTATTCTTAATATTAAACAAATAATCAAACAAATTATACATAATTTGATTATT
CTACATATGCATTACATTCATTCATTCATTTCTCATACTTTATGTTAACAAATATAGTTA
TCCACTTGTTCAGCTCCAAATTTATCCTTCAGTTCTTAATTTCAAAGAAAAGTAAATCAT
TGATCAGAAAATATTTATTTTATTTCTGATTGTTTGTTGCATTTGATTCTTTTCACTGCA
ACTTATAATCATCATTCATTCATTAATTCATTATCATTCATTTTTCATTTTTTAAATTAT
TCTCTCATTTAATTCAATAGAGACCAAAAGTGAAGAACCTCACAATATGCAAGATCTCCG
CAATCCTTGAGAAGATTCAGGAAAATTCCTCTGCGATTCCACATTACAACTTTTAGAAAC
ACAAGATGATTGTATTTGACTTGGAAGAAGATTTACAAAAATTAAAATTAACCTAATAAG
ATATATACACATAGAATAATTTAGTCTCTATTAAAGAATTTCTATACAAAATATAAAGTA
ATTTGAAATGCCCAGATGAGTATTTCGTAGCAGCATTTTTGCTCATTTTAAAGTATTTGA
GCCTTTCTTCAATTTAATTCACAGAAAACAACTGCTAAAGGTACTTTTTACACATTTATC
TTAATTTTTTATGCAACATAAATCATAGATCAGTTATATAAAAACAAAAATAGTTAATTC
ATACTCAAATAAATTCTTCTTTTAGAAGGCATTTTGTCTAAAGAAGTCTGCAATTTTACA
ACTAAAAAGAATAATCAATATTTTATTTATTGACTTCTTTCTTTCTTTCTTAATTTCTCT
GCTGAGTGTCTTTAATGAATGCACATAATAGATGCTTTCATAGAAATTTTATAATAGGAT
CTAAACAACCAGCTTTCCAAAACTAACCAAATAATAAACACACAAACAAACAATCAAGCA
AACAAACAAATAAAGTTATAACTAACTTATTGTATGCAGATACAAAATTTTTTAACCAGC
AAATTGGTTTGTTTGTTTGTTTGTGATTTATTTACTCATTTGCTATAGTTTTTACACACG
AAATTATCAAATTAAGTAATAATTCATGCTTCCAAATAGATTTCTAATTTACTATTAAAA
AATAATACTAAAAATTTTCACTTCGCCGTACTCATATAGCGAGTCACTTTTCTTTGTTAT
GTCATTAATTAAAAACAGACATATGATTATTGCGGCATAACAATTTCTATAAGTTATTTT
ACAACTTTAACACGACGTTTACAACTAAATAAATCTTAAATAGAAACAATCAATTAAATA
TATTATTTTTAAATTTTAGCATGAAAACTATTTTTAAATACTTCCTCTATTACGAAGAAA
AAGTTGCTTTACTTTTTAATTTTTCTTCTTCTGATTTGATTGTTGTGAGTGCTGAACTAG
TCTTAAAAATTATAAACAGATATATTATTAAAGATTAATAAATATTAATAGATTGATTGA
TTGATATATACTTTGATTAATTTAAAAATTATAAATAGAAAAACAAATTTTCAAAAAATT
AAGCTAAGCAAATAAGATTTTACAACTTAATACTAATTCAAATAAGTCCCCCACATAAAA
TAGCCAAGCAATTTGTTCATTTATAATTACTACTATAGATGATTTATAATTTTTATCATC
AATATTAAATATCACTTCAGTTAAAAGCCAACAAAATTAAACATAATAACTCAGCACATT
TATAAATACCTACATAGAAATTAATATTTACTAAAAATTTCATGTAACACGCATAATTGT
AAAGGATATTGATTACTCTCATAAAATTATTGGTGAAATCAAAAACTATAAAATTGATTA
GATTTCTAATTAAAAGAATTTATTTGCATACAAATTGATATTCTATTTCAAATAATTTTA
CTAATAGAATTTTTTATTTAAAATAGATTGATTGCCTGCGCCATTATGCTTATAGAAAAA
TAATATAGTGATTATATATTATCACTCTACGCCTACTCTAGAGGAGTAAACATACCTGTT
AAAGATTTATAAGAAATGGAATTATAATTTTTGTCTACAATAAACTGGGAAATTAATATT
AAAGAAGAAGAATTTCAAGCTTTTTAAGAGTATTTCAACACAATAAGCGCATGA