Identifiers and Description

Gene Model Identifier

TTHERM_00726380

Standard Name

CYC30 (Cyclin 30)

Aliases

PreTt21903 | 117.m00155

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00726380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04628.19.997093137033517e-262hypothetical protein (319 aa)
OxytrichaContig11713.0.g240.000000000000004001928599951003Cyclin, N-terminal domain
DictyBaseDDB_G02866170.000000019990673443141236cycK on chromosome: 4 position
4722525 to 4724281
WormBaseWBGene000005070.000008000552149328928locus:cit-1.1 Cyclin-T1.1
status:Confirmed UniProt:P34
425 protein_id:CCD63445.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00726380(coding)
ATGAAATTGTACAAGAAAAGTGAGATATTTTCTGAAAAATATAATAAGAATAGTGAATTA
GAAATAAGTCCAGAAGTTCAAAAGAAAATCATGGATGGAAATGCTGCATTTATAATTGAT
TTAATAGCAAGTTTAAAAATTCCTAGCTTCACTATATCATCACTTGGAATCCAGCTCGTT
AATTATTTTTTTATTGGAAAGAGCTACTTGAACTATGATAGATTCATTTACTGTGCTGCT
GCTTTGATGCTGGCATTTAAAATAAAGGAATAAGATCATTATAGGTTAAAGCCTATTATT
ATGGGATATTACCAGTAAGCACCAAGAAGGGACTAGACATAGATAATGAATGATACGATA
TATTAATAAATTAAAAATAAAATTTGCATAGCTGAAAGCAAATTGTTAAAAGCAATATAA
TTTGAATTCGATATATAGCTTCCCTTTGATTTCTTGCAAACAATTATTGAATTCTGTAAT
GAAAAAGATCAAGATAAAGAACGTATATATTATGCCACTAAGGTAATAAGTTATGATAGC
TTTAGAAGTTATGCTCCTCTTATTTTTAAACCACAAATTATAGCTGTTTCTGCTTTTATG
ATTAGCTGCTCTTAATTTAACATAGAACCACACTTAAGAATTCCTGAAAGATTCAAAGAA
AAGTATAATCCTGAGACTATGAGAGAAGAAGAAGCTTATGAAAGATGGCTGCAAGAAATT
TCTATAGAATTAAAAACATAAATTACTGCTGAAGATATAAAAGATTGCTTGTACGTACTA
AATGAACTTCTTTATCTTCACTATAATCCTAAAGAAGATGATTTAAAAAAATTTGAATAG
TATGAAACCTCTCTTGAATAAAGCAAAATTAAAAATGATCAAAATGAAAAACCAAATTAA
GAAAAATAGACTGAATAAAAAATGGATATTGAATAATAGTGA


>TTHERM_00726380(protein)
MKLYKKSEIFSEKYNKNSELEISPEVQKKIMDGNAAFIIDLIASLKIPSFTISSLGIQLV
NYFFIGKSYLNYDRFIYCAAALMLAFKIKEQDHYRLKPIIMGYYQQAPRRDQTQIMNDTI
YQQIKNKICIAESKLLKAIQFEFDIQLPFDFLQTIIEFCNEKDQDKERIYYATKVISYDS
FRSYAPLIFKPQIIAVSAFMISCSQFNIEPHLRIPERFKEKYNPETMREEEAYERWLQEI
SIELKTQITAEDIKDCLYVLNELLYLHYNPKEDDLKKFEQYETSLEQSKIKNDQNEKPNQ
EKQTEQKMDIEQQ


>TTHERM_00726380(gene)
ATGAAATTGTACAAGAAAAGTGAGATATTTTCTGAAAAATATAATAAGAATAGTGAATTA
GAAATAAGTCCAGAAGTTCAAAAGAAAATCATGGATGGAAATGCTGCATTTATAATTGAT
TTAATAGCAAGTTTAAAAATGTAAATAATTGTTTTTTGAGAGATTTGGTTTTAATTTATA
CATAATTTATTAGCCAAGTTTATTCAAATAGTAATTTAAGACATTTCTTTAAAAATCCTA
TAGTCCTAGCTTCACTATATCATCACTTGGAATCCAGCTCGTTAATTATTTTTTTATTGG
AAAGAGCTACTTGAACTATGATAGATTCGTAATTACGCATTTACAAATGAATGAAATTAA
TTCAAATCAAAGAAAGTTTATTCGAAAAATACATCAAAAAATATGAATAAACAAATATAA
TTGAGAAGAATATAATTTTGAATTTATATTATTATCATAATGCATTATAAAATGGGAGTT
AGTTAGTTAATTGATTTTATTTTTAATTAGATTTACTGTGCTGCTGCTTTGATGCTGGCA
TTTAAAATAAAGGAATAAGATCATTATAGGTTAAAGCCTATTATTATGGGATATTACCAG
TAAGCACCAAGAAGGGACTAGACATAGATAATGAATGATACGATATATTAATAAATTAAA
AATAAAGTAAAAAATAATAATAATAAATAATTTTAATCTAATTAAATTATAAATAAAAAA
GATTTGCATAGCTGAAAGCAAATTGTTAAAAGCAATATAATTTGAATTCGATATATAGCT
TCCCTTTGATTTCTTGCAAACAATTATTGAATTCTGTAATGAAAAAGATCAAGATAAAGA
ACGTATATATTATGCCACTAAGGTAATAAGTTATGATAGCTTTAGAAGTTATGCTCCTCT
TATTTTTAAACCACAAATTATAGCTGTTTCTGCTTTTATGATTAGCTGCTCTTAATTTAA
CATAGAACCACAGTAATAATCTTTTTTTATTATTTCAGTTGAATAAAATAATATGTTCAA
TTATTAGCTTAAGAATTCCTGAAAGATTCAAAGAAAAGTATAATCCTGAGACTATGAGAG
AAGAAGAAGCTTATGAAAGATGGCTGCAAGAAATTTCTATAGAATTAAAAACATAAATTA
CTGCTGAAGATATAAAAGGTAATTTTATTTAGACTAATTTTAAAATCAAATTTATTTATT
TTATTGTTTAAATAATTATAAGATTGCTTGTACGTACTAAATGAACTTCTTTATCTTCAC
TATAATCCTAAAGAAGATGATTTAAAAAAATTTGAATAGTATGAAACCTCTCTTGAATAA
AGCAAAATTAAAAATGATCAAAATGAAAAACCAAATTAAGAAAAATAGACTGAATAAAAA
ATGGATATTGAATAATAGTGA