Identifiers and Description

Gene Model Identifier

TTHERM_00180970

Standard Name

CYC3 (CYClin)

Aliases

PreTt29815 | 14.m00382

Description

Cyclin, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00180970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09948.19.997093137033517e-262cyclin domain-containing prote
in (630 aa)
OxytrichaContig14947.0.g374.9986056260133516e-43Cyclin, N-terminal domain
SGDYPR119W2.9992476920535046e-16CLB2 B-type cyclin involved in
cell cycle progression; activ
ates Cdc28p to promote the tra
nsition from G2 to M phase; ac
cumulates during G2 and M, the
n targeted via a destruction b
ox motif for ubiquitin-mediate
d degradation by the proteasom
e
WormBaseWBGene000008650.000000000000020000882446601127locus:cyb-1 G2/mitotic-speci
fic cyclin-B1 status:Confirm
ed UniProt:Q10653 protein_
id:CAA94384.1
Stentor CoeruleusSteCoe_200660.000000000005109089028063325

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64
  2. Ref:SUPR000105

Sequences

>TTHERM_00180970(coding)
ATGAAATCAAGCATTAAATGTAGGTTGGAAGAAATATAGTTGTTAAATATTAATCAAAAA
TAAAGTAAAAAAATAAGTAATTACGAAAAACAATTAAGTGGCAAAAACAAAAGTAAGAAA
GTAATAAAAAATATATATAATTATTAATAAAATCAAAGAGCAAACAAGAAAACTTGCGCT
AAATTGGGCAAATAGTTATAAACGCCAGATATAAATAATATTTTAAGAGAAACAAATTAG
ACAAAAACTTAAGTAGAAACAGCAGCAGAGCACCTCTTAGCTACTAATAAAAAAAAGCAT
ATTTCTAAGAGCAACTTCCACAAAATTTTATCATACCTAATTTAGCCATTCAGAAAGCTC
ATTTAACAAACTTAGTCTTATTAAAACCTGCAAAATCCTTCCATACAAATGATTAGATAA
AGAAGTTTCGTAACTAACAACAAGGAAAACAACGCTGTCATCAGCAATATCGAGAGCGAG
AATTTAGATGAAAAGGATAAATCTCAATATTCCTACGGAAAGATCTAAGGAGTCATCTCT
ACTGCTTCTACTAACGCCAGCTAAGGTTTGAAAAGCATTCCTGCTAGCAATAACAATTAC
AACAATAATAATGCTAAAAAATCTATTTAAACTCAGAATAGTATTCTCATGGAGGAAGAC
TATTGCTATGAAAGCACTGATTCCTAGAAGGGCCAAGATGCAAACGGATCCTACGGCTCT
AACGGAAATAACAGTCACAATTCTACTAATGGAAACTCTAACTCTAAGGGATAGACTTAC
ACCAGCAGCATAACTGCTTAGATGCTCCTTAACGACGTTAGAGCCTTAGCTGCTTAGAAC
TTAAAGACTGAATAAAATCTCCGCGATCTATAGAAGAAGATTAATCTCTAAAAGAACAAG
AGATTCACTCAATACACTTAAGACAATAAAGAAAATGTCTACATGGGACCAGGTGACAAG
AAAATCTCCAGAAATAACAGTTAAAAGGACCAGTGTAATCTTTCTTAAAACGAAAACTAT
TAAAGCAATCCCTACACAAACAAAAACAATTTATCCATGAATAACAATAAAATATTGAAC
AACAACAACAACAATAACTACTAAAAGTAATAACAGTAGTAAGCTCCTGTCCTTAACTAA
ATCACAAGCAACTATTAGAATCATGCTTAGAAGTAATAAATCTCATAAAATATTGGTAGT
GAATAAAACTTTTTGTAAGGGTAGAACTAACTAAACCTAAAGAACAATAAAATACCTAAT
TAGAAACCTCAAATAGTTGAATAAATTAAACAATAAAATATTTAACAAATTGCTCCTATT
GCCGCTGAATAACTTAAGAAAGTACAAAACAATAAGAAAATTGATGGCTTAAACCTCTCT
GATTAACAAGGAAATAAAAGATAAATTCTAAAACAGAAGATCCAATAAGAAGAACAATAA
AAAAGAGAAGGCGATAACTAAGCCTAAGAATCCGACTAGTAAAACGCCGATTACCAATAC
AAAGTTGACAAACTCTACAGAGAAGAATCATTTACAACAAGACTTGCAAGACTCATTATC
AACGAAAATTACTCCTTCGACATTCTTAACCACATCATACAAAGAGAGCCTTAAACAGTC
CCCAAGAATTGCCTCTAAAATCATGATATCTCTTATTAATTAAGAGCCAAGATGGTTGAC
TGGATGATTGAAGTCATGAAATCCTATAAATGCTCAGAAGAAACTTACTTTATGGCTGTC
AGAATTATGGACTCTTTCTTGGAGAAATGCAAATAAAAGAAATCACCATTAGATATCCAC
TTAATTGGTGTCACTTGCATTTTTATTGCAAGTAAGTATGAAGAAATTTACCCATTACGT
ATATAAATCATTGAAGAGAGAATTTCCCACAATAAATTGTCACAAGAACAAATCAAGTAG
ACTGAGGCAGAAATCTTAAATACTTTAGATTTCAAATTACTAGGAACTTCTCCTTATGAA
ATTGCTATGTAAACTCTTACATTAATTGGACTTTAGGACAAATTAAGCCACGAAGAATTC
TAATACTGCCACAGAGTCTGCTTATATCTTTGCAAGATGATTCTCTACGACTACGAATAC
TTCAAGAGCATCCCATACTCTGTCTCTGCTGCATCTATTATGTACATTGTCTTCAAAATT
TTCAACTAAATGATCTAAGAATTCTCCGCTGATGTTATTATTTAAACTGTCATTCAAATC
CTTCAAGTCGATAAAAACACCTTGATTCAATCTAGTGCAAGAATCTTAAATTTAGCCAAA
AACTTTGATGAATACTTCCCTGATTTGAAGAACCTCAAAAAATTCAATGGATTCGAAACT
ACAGGAGAATCTAACTCTATCTAAGATTCAAAAAGACATAAGGAAAGAAGTGAAAGCAGC
CAAAATGATAAATAAGGCCTTAATTTAAAGCAAAACGATAAATAAAAATTAGAAGAAATT
TCCTCTAAAGCTATGTAAGTAGAAAAGTAACAAGAATGA


>TTHERM_00180970(protein)
MKSSIKCRLEEIQLLNINQKQSKKISNYEKQLSGKNKSKKVIKNIYNYQQNQRANKKTCA
KLGKQLQTPDINNILRETNQTKTQVETAAEHLLATNKKKHISKSNFHKILSYLIQPFRKL
IQQTQSYQNLQNPSIQMIRQRSFVTNNKENNAVISNIESENLDEKDKSQYSYGKIQGVIS
TASTNASQGLKSIPASNNNYNNNNAKKSIQTQNSILMEEDYCYESTDSQKGQDANGSYGS
NGNNSHNSTNGNSNSKGQTYTSSITAQMLLNDVRALAAQNLKTEQNLRDLQKKINLQKNK
RFTQYTQDNKENVYMGPGDKKISRNNSQKDQCNLSQNENYQSNPYTNKNNLSMNNNKILN
NNNNNNYQKQQQQQAPVLNQITSNYQNHAQKQQISQNIGSEQNFLQGQNQLNLKNNKIPN
QKPQIVEQIKQQNIQQIAPIAAEQLKKVQNNKKIDGLNLSDQQGNKRQILKQKIQQEEQQ
KREGDNQAQESDQQNADYQYKVDKLYREESFTTRLARLIINENYSFDILNHIIQREPQTV
PKNCLQNHDISYQLRAKMVDWMIEVMKSYKCSEETYFMAVRIMDSFLEKCKQKKSPLDIH
LIGVTCIFIASKYEEIYPLRIQIIEERISHNKLSQEQIKQTEAEILNTLDFKLLGTSPYE
IAMQTLTLIGLQDKLSHEEFQYCHRVCLYLCKMILYDYEYFKSIPYSVSAASIMYIVFKI
FNQMIQEFSADVIIQTVIQILQVDKNTLIQSSARILNLAKNFDEYFPDLKNLKKFNGFET
TGESNSIQDSKRHKERSESSQNDKQGLNLKQNDKQKLEEISSKAMQVEKQQE


>TTHERM_00180970(gene)
ATGAAATCAAGCATTAAATGTAGGTTGGAAGAAATATAGTTGTTAAATATTAATCAAAAA
TAAAGTAAAAAAATAAGTAATTACGAAAAACAATTAAGTGGCAAAAACAAAAGTAAGAAA
GTAATAAAAAATATATATAATTATTAATAAAATCAAAGAGCAAACAAGAAAACTTGCGCT
AAATTGGGCAAATAGTTATAAACGCCAGATATAAATAATATTTTAAGAGAAACAAATTAG
ACAAAAACTTAAGTAGAAACAGCAGCAGAGCACCTCTTAGCTACTAATAAAAAAAAGCAT
ATTTCTAAGAGCAACTTCCACAAAATTTTATCATACCTAATTTAGCCATTCAGAAAGCTC
ATTTAACAAACTTAGTCTTATTAAAACCTGCAAAATCCTTCCATACAAATGATTAGATAA
AGAAGTTTCGTAACTAACAACAAGGAAAACAACGCTGTCATCAGCAATATCGAGAGCGAG
AATTTAGATGAAAAGGATAAATCTCAATATTCCTACGGAAAGATCTAAGGAGTCATCTCT
ACTGCTTCTACTAACGCCAGCTAAGGTTTGAAAAGCATTCCTGCTAGCAATAACAATTAC
AACAATAATAATGCTAAAAAATCTATTTAAACTCAGAATAGTATTCTCATGGAGGAAGAC
TATTGCTATGAAAGCACTGATTCCTAGAAGGGCCAAGATGCAAACGGATCCTACGGCTCT
AACGGAAATAACAGTCACAATTCTACTAATGGAAACTCTAACTCTAAGGGATAGACTTAC
ACCAGCAGCATAACTGCTTAGATGCTCCTTAACGACGTTAGAGCCTTAGCTGCTTAGAAC
TTAAAGACTGAATAAAATCTCCGCGATCTATAGAAGAAGATTAATCTCTAAAAGAACAAG
AGATTCACTCAATACACTTAAGACAATAAAGAAAATGTCTACATGGGACCAGGTGACAAG
AAAATCTCCAGAAATAACAGTTAAAAGGACCAGTGTAATCTTTCTTAAAACGAAAACTAT
TAAAGCAATCCCTACACAAACAAAAACAATTTATCCATGAATAACAATAAAATATTGAAC
AACAACAACAACAATAACTACTAAAAGTAATAACAGTAGTAAGCTCCTGTCCTTAACTAA
ATCACAAGCAACTATTAGAATCATGCTTAGAAGTAATAAATCTCATAAAATATTGGTAGT
GAATAAAACTTTTTGTAAGGGTAGAACTAACTAAACCTAAAGAACAATAAAATACCTAAT
TAGAAACCTCAAATAGTTGAATAAATTAAACAATAAAATATTTAACAAATTGCTCCTATT
GCCGCTGAATAACTTAAGAAAGTACAAAACAATAAGAAAATTGATGGCTTAAACCTCTCT
GATTAACAAGGAAATAAAAGATAAATTCTAAAACAGAAGATCCAATAAGAAGAACAATAA
AAAAGAGAAGGCGATAACTAAGCCTAAGAATCCGACTAGTAAAACGCCGATTACCAATAC
AAAGTTGACAAACTCTACAGAGAAGAATCATTTACAACAAGACTTGCAAGACTCATTATC
AACGAAAATTACTCCTTCGACATTCTTAACCACATCATACAAAGAGAGGTAATAATTAAT
TTATTTATTTAGTAATTCTTACAAATTGATTGGTAGATTGATTAAAAAATTGACCGTTTA
ATTTATTTAATCTACTTAATTAATTAATTTGTAACAGCAACTTTTTATTAGAAGCCTTTT
CTAAATATATAATTTTAATTAATAAATTAATTAGCCTTAAACAGTCCCCAAGAATTGCCT
CTAAAATCATGATATCTCTTATTAATTAAGAGCCAAGATGGTTGACTGGATGATTGAAGT
CATGAAATCCTATAAATGCTCAGAAGAAACTTACTTTATGGCTGTCAGAATTATGGACTC
TTTCTTGGAGAAATGCAAATAGTAAATTAAAAAATATTAACATTTTTTAATGTATTAAAT
TTATTTTTGTATTTAATAGAAAGAAATCACCATTAGATATCCACTTAATTGGTGTCACTT
GCATTTTTATTGCAAGTAAGTATGAAGAAATTTACCCATTACGTATATAAATCATTGAAG
AGAGAATTTCCCACAATAAATTGTCACAAGAACAAATCAAGTAGACTGAGGCAGAAATCT
TAAATACTTTAGATTTCAAATTACTAGGAACTTCTCCTTATGAAATTGCTATGTAAACTC
TTACATTAATTGGACTTTAGGACAAATTAAGCCACGAAGAATTCTAATACTGCCACAGAG
TCTGCTTATATCTTTGCAAGATGATTCTCTACGACTACGAATACTTCAAGAGCATCCCAT
ACTCTGTCTCTGCTGCATCTATTATGTACATTGTCTTCAAAATTTTCAACTAAATGATCT
AAGAATTCTCCGCTGATGTTATTGTAAATTATTATTTTTATATGAAAGAACTAAGTAACT
GAAAATTTTATTTTAACTTTAAAAAAAGATTTAAACTGTCATTCAAATCCTTCAAGTCGA
TAAAAACACCTTGATTCAATCTAGTGCAAGAATCTTAAATTTAGCCAAAAACTTTGATGA
ATACTTCCCTGATTTGAAGAACCTCAAAAAATTCAATGGATTCGAAACTACAGGAGAATC
TAACTCTATCTAAGATTCAAAAAGACATAAGGAAAGAAGTGAAAGCAGCCAAAATGATAA
ATAAGGCCTTAATTTAAAGCAAAACGATAAATAAAAATTAGAAGAAATTTCCTCTAAAGC
TATGTAAGTAGAAAAGTAACAAGAATGA