Identifiers and Description

Gene Model Identifier

TTHERM_00649450

Standard Name

CYC29 (Cyclin 29)

Aliases

PreTt09259 | 94.m00177 | 3677.m00085

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00649450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17898.11.999534248571833e-46hypothetical protein (336 aa)
OxytrichaContig5966.0.g110.000009999254677478949Cyclin, N-terminal domain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00649450(coding)
ATGGAAAATAAAAACTAGACTAATCAAAACAACAGCAGCTTTTAAAGCAATGACCTTACA
ACTTTAATCAAATAGGATTACGAGATCAGAAATTAATACTGCACTTTCAGTAATGGTCTG
TAATAAAATCTACTATACGCTCGTGAAAAAATTCTTTATTGGGTTTTAGATGTAATGGAG
AAAATTGAGCTATCCTTAAGGTCGATCGAAATATTCGTCTTCATTTTTGAATTACATTGG
GTGAAAAATTAGAATTCTATTCCTAAACAAGAGTTATAAAAGCTAGCTTTGAGCTCCCTT
TATTTAGTCATTAAGGAAATAGAAAATGAAGAAATAACTGTCGATTATCTAAATTATATG
TGTAAAAATGCCTATTCTAATGAAGAAATAGAAACTTAGATAAAGGATTAGATGAATTCC
TTGCCAAATCTTAATTTTATAATTACTCCATCTATTCTTTTACCAGCTTTTAAGATTTAG
ATTGACGAAGAAGACTACAAAACTGCATCACTTTTCGTTTATTAAACTTACGATAATATT
ATAAGTCTGAATTCTTCAGAAATACTTTTCATTACTCTCAAATTTATACAAACTTCTCCT
CTCATAAATAGTAAATATGAGGACGAGAATATTAAAGCTATTATAAAATTACTTGCGCCT
TTTATTTCTTCCTCATTAGAATAGCTTGAGCAAATAGTAAAAGAAATTAATGAATTTGTA
GAACAACACGATGATAATCTCTCTGAAGACTTTAATTTTCCTAATGGTTCCTCTTAAGAC
ATCAAAATTCGCAAAATGTCTTTAGAGTGCGATTTATCTATGAACTAGCAAAAATAATTT
GATGGTGAATCTTAAATTCTTAACAATATCTCTGATAATAGCTTTTAAGACAATGATCAC
AACATCTCAATAGAGCAAGAAATAAAAAGTAATAGAGCTAATAGCAAACATCTAGATTAA
GATATTTAGAACAACAAAGACAATGACTTTTTGCTTAATATTTTTGTTGATAAAAATGAA
AAAAATAAGTAAGAAGAAATGGAAAAGCCCTAGTCTTGTAGCGATTGCTTCTATTTCCAT
AAGAGCAACTGCAATTTTGATTCAGGCATCTTTTCTTCCTTTGCATAATTGAATGATTTA
GAGCTCAAAGGTGATACTATTTCTAATGTATCAACCTGCACTCCTATAAATAGTAACTAT
AATAGTAATAATCTTTACAATAGCAACAATACTCATTTTAATAGTTTAAACACTTAAAAT
AATATGAATAACTCTGGTCAACTTCACTAAGCATCATACCATTCACACATTTAGAGTCCT
AATCTCACTAGCTTAAGGAGCAACAATAAAAATATAAATAATTAACATTTCAATACCAAC
TTTAGTTCATCAGATAATAGTTTCGCTAAATGCATGACAAACAGCTTAAATAAATAAAAG
TAACCTGATGATATCTTATAAAGCTAATAAAATCTTAACTCTATATCTACCCGTCTCACT
CTAGATGAAGAGCAACAAATAGAATGA


>TTHERM_00649450(protein)
MENKNQTNQNNSSFQSNDLTTLIKQDYEIRNQYCTFSNGLQQNLLYAREKILYWVLDVME
KIELSLRSIEIFVFIFELHWVKNQNSIPKQELQKLALSSLYLVIKEIENEEITVDYLNYM
CKNAYSNEEIETQIKDQMNSLPNLNFIITPSILLPAFKIQIDEEDYKTASLFVYQTYDNI
ISLNSSEILFITLKFIQTSPLINSKYEDENIKAIIKLLAPFISSSLEQLEQIVKEINEFV
EQHDDNLSEDFNFPNGSSQDIKIRKMSLECDLSMNQQKQFDGESQILNNISDNSFQDNDH
NISIEQEIKSNRANSKHLDQDIQNNKDNDFLLNIFVDKNEKNKQEEMEKPQSCSDCFYFH
KSNCNFDSGIFSSFAQLNDLELKGDTISNVSTCTPINSNYNSNNLYNSNNTHFNSLNTQN
NMNNSGQLHQASYHSHIQSPNLTSLRSNNKNINNQHFNTNFSSSDNSFAKCMTNSLNKQK
QPDDILQSQQNLNSISTRLTLDEEQQIE


>TTHERM_00649450(gene)
ATGGAAAATAAAAACTAGACTAATCAAAACAACAGCAGCTTTTAAAGCAATGACCTTACA
ACTTTAATCAAATAGGATTACGAGGTTTTATATTTAATTAATTTGAACATATCCTGATAA
ATTTTTACAATAATTTAACTCTCATCTAAACACATTTTTTATTAAAATAGATCAGAAATT
AATACTGCACTTTCAGTAATGGTCTGTAATAAAATCTACTATACGCTCGTGAAAAAATTC
TTTATTGGGTTTTAGATGTAATATTACTATTATTATTTATATGGATATACTAAAAATACG
AAACGTTTGTCACTCATTTTGTGGTTACAGTAGCATTTAAATTGAAACATTTGCAATATA
AATTGAATAGCTTTTGAGTTGTTTATTTAATTATTTATTAATTGATTGATCAAGGCTGTA
ATCAATATTTTTATAAAAACACATTTTACTCGAAAACAATTGATTTACGAGGATAGGGAA
ATTAATTATAAATACCAAAAACTTTTTTTATAACTTTTTTATGTAAACTTTTCATAGAAA
GTAGATAGAAAAAAAAGTAAATCAAAAGAATAAAATAGACATATTAACTTTAATTTTATC
GAATTAAATAATTCTTATCTCTTTTTACCATTAAAATTATTATTTAATTCTTATTTTTTC
TATTTTACTTTACAATTTTTATGGGGTATCTAAGAGACTGAAATTAAACAAATGAGCTTA
AATATTTTACTCAACTTTTAATGTATCTTAAACCACAAAACATTCAATTATTTTTCAAAT
TTATCCTTTACTTTTACAGGATTAATACATATTTTTTTACTATTGAAATCATCAGGTAAT
GGAGAAAATTGAGCTATCCTTAAGGTCGATCGAAATATTCGTCTTCATTTTTGAATTACA
TTGGGTGAAAAATTAGAATTCTATTCCTAAACAAGAGTTATAAAAGCTAGCTTTGAGCTC
CCTTTATTTAGTCATTAAGGTAGCAATTTTTTATTTAACAAAGATTAAATAAATTAATTG
AAAAATTCAAAAAATTTATTTAATATTTCCTTTTTGTTATTAGATTACTTACTAATAATT
TGATTTCTTTGGTAAAGTTGGATTTGATAAATCAAATATTCATCTTATAATTATTATAGT
AGAAATTTTAAATCAAAATCCAACATTAAAAATTAATTTTAATTGATTGCTTATCAAATT
CAATCAACTTCCCACCCTAATGGAACAAGGTTTTCAAAATTTTATTATTATAAATACCAA
ATATTTTAGATATTGTCATTACCTTTAGCAATCAATCAATAACTTGCATCGCATTTAAAA
AACACTCTTTTATTTTTTCCCATTTTACAAATAACGCTATTCTTTGGTTGAATCCTAAGT
ATTTTTTCTTTAATTCCGATTCATATTTTTGTTAAAATTTAATAAAGATTCATTTATAAA
TGCTAAATAAATATCAAATGGCTTATTTTTGATTCTGAGATACCCTTCATTTATAATTTT
AAAATAAAATTTAAACATTTAATATGATTTTATTTTATTTCTTTATGCCAAAATGCTTGA
AAAAAGATATTAAAATAGAGTTAAGATTTATCAGATTTATCTTACAAATTAAAGCATATA
ATTTTGGATTTTTAGTTAAATTTTTATTCAAGCATTTGATAAAGTTTAAAATTAAAACTG
GTTAAGACAGTGGATGAAAATATGGATTTACAAAGATAGTAAACATACCTCTTAAAAGTA
TCCAAGAATTTATAACTACTTTTTAAGAGAAAATTAATTCAATATAATTCTATAACCCTT
ACTTCGGTTGGAGGGAAGGAATTTCTTTTTTCATTTATATTTGATTTCTTAATTTTGAAA
TATTCATTACAGCTTGAATAAATGCTTAATCGGAATTTCTCATGTGTGGGAGAAAGAAGA
TACATAAACATAAATAAATATAAATTTTTTTATAAATTTAATGGAATGAATATCTTCTTT
TCAGTCAAATTAAATCAAATTATTTGAAATAGATTTGATCTTAATGACATATTTTACTTT
TAAATATTAGGAAATAGAAAATGAAGAAATAACTGTCGATTATCTAAATTATATGTGTAA
AAATGCCTATTCTAATGAAGAAATAGAAACTTAGATAAAGGATTAGATGAATTCCTTGCC
AAATCTTAATTTTATAATTACTCCATCTATTCTTTTACCAGCTTTTAAGATTTAGATTGA
CGAAGAAGACTACAAAACTGCATCACTTTTCGTTTATTAAAGTAAAAAATTTTATTTAAT
AAATAAAAACACATTTTTTGAAGCTCTAACCAGCTAAATATCTAAAGATACAATCTATTA
ATTCAATTTGATACGTTAAATAAATTTTATAATTAATTTGCATCTAAAATAAAAAAACTG
ATTAAAACTATGCTTATAGATATATTTTAATAAATTTATTAGCTTATTCAAAATCAAACA
CAAATAAAGTAACAAGTATTATGATTAGTAAGATTGTAATCAAAAAAATATATTTACAAC
CTGTTACTTAAAATAAAAGAGCAAAGGAATTCAATTTACCACAAAATTTTTTATTTTGAT
TTTTTTAATAACTAACTATTTTTTAAATATCAACCAGCTTACGATAATATTATAAGTCTG
AATTCTTCAGAAATACTTTTCATTACTCTCAAATTTATACAAACTTCTCCTCTCATAAAT
AGTAAATATGAGGACGAGAATATTAAAGCTATTATAAAATTACTTGCGCCTTTTATTTCT
TCCTCATTAGAATAGCTTGAGCAAATAGTAAAAGAAATTAATGAATTTGTAGAACAACAC
GATGATAATCTCTCTGAAGACTTTAATTTTCCTAATGGTTCCTCTTAAGACATCAAAATT
CGCAAAATGTCTTTAGAGTGCGATTTATCTATGAACTAGCAAAAATAATTTGATGGTGAA
TCTTAAATTCTTAACAATATCTCTGATAATAGCTTTTAAGACAATGATCACAACATCTCA
ATAGAGCAAGAAATAAAAAGTAATAGAGCTAATAGCAAACATCTAGATTAAGATATTTAG
AACAACAAAGACAATGACTTTTTGCTTAATATTTTTGTTGATAAAAATGAAAAAAATAAG
TAAGAAGAAATGGAAAAGCCCTAGTCTTGTAGCGATTGCTTCTATTTCCATAAGAGCAAC
TGCAATTTTGATTCAGGCATCTTTTCTTCCTTTGCATAATTGAATGATTTAGAGCTCAAA
GGTGATACTATTTCTAATGTATCAACCTGCACTCCTATAAATAGTAACTATAATAGTAAT
AATCTTTACAATAGCAACAATACTCATTTTAATAGTTTAAACACTTAAAATAATATGAAT
AACTCTGGTCAACTTCACTAAGCATCATACCATTCACACATTTAGAGTCCTAATCTCACT
AGCTTAAGGAGCAACAATAAAAATATAAATAATTAACATTTCAATACCAACTTTAGTTCA
TCAGATAATAGTTTCGCTAAATGCATGACAAACAGCTTAAATAAATAAAAGTAACCTGAT
GATATCTTATAAAGCTAATAAAATCTTAACTCTATATCTACCCGTCTCACTCTAGATGAA
GAGCAACAAATAGAATGA