Identifiers and Description

Gene Model Identifier

TTHERM_00649450

Standard Name

CYC29 (CYClin 29)

Aliases

PreTt09259 | 94.m00177 | 3677.m00085

Description

Cyclin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00649450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17898.11.999534248571833e-46hypothetical protein (336 aa)
OxytrichaContig5966.0.g110.000009999254677478949Cyclin, N-terminal domain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00649450(coding)
ATGGAAAATAAAAACTAGACTAATCAAAACAACAGCAGCTTTTAAAGCAATGACCTTACA
ACTTTAATCAAATAGGATTACGAGATCAGAAATTAATACTGCACTTTCAGTAATGGTCTG
TAATAAAATCTACTATACGCTCGTGAAAAAATTCTTTATTGGGTTTTAGATGTAATGGAG
AAAATTGAGCTATCCTTAAGGTCGATCGAAATATTCGTCTTCATTTTTGAATTACATTGG
GTGAAAAATTAGAATTCTATTCCTAAACAAGAGTTATAAAAGCTAGCTTTGAGCTCCCTT
TATTTAGTCATTAAGGAAATAGAAAATGAAGAAATAACTGTCGATTATCTAAATTATATG
TGTAAAAATGCCTATTCTAATGAAGAAATAGAAACTTAGATAAAGGATTAGATGAATTCC
TTGCCAAATCTTAATTTTATAATTACTCCATCTATTCTTTTACCAGCTTTTAAGATTTAG
ATTGACGAAGAAGACTACAAAACTGCATCACTTTTCGTTTATTAAACTTACGATAATATT
ATAAGTCTGAATTCTTCAGAAATACTTTTCATTACTCTCAAATTTATACAAACTTCTCCT
CTCATAAATAGTAAATATGAGGACGAGAATATTAAAGCTATTATAAAATTACTTGCGCCT
TTTATTTCTTCCTCATTAGAATAGCTTGAGCAAATAGTAAAAGAAATTAATGAATTTGTA
GAACAACACGATGATAATCTCTCTGAAGACTTTAATTTTCCTAATGGTTCCTCTTAAGAC
ATCAAAATTCGCAAAATGTCTTTAGAGTGCGATTTATCTATGAACTAGCAAAAATAATTT
GATGGTGAATCTTAAATTCTTAACAATATCTCTGATAATAGCTTTTAAGACAATGATCAC
AACATCTCAATAGAGCAAGAAATAAAAAGTAATAGAGCTAATAGCAAACATCTAGATTAA
GATATTTAGAACAACAAAGACAATGACTTTTTGCTTAATATTTTTGTTGATAAAAATGAA
AAAAATAAGTAAGAAGAAATGGAAAAGCCCTAGTCTTGTAGCGATTGCTTCTATTTCCAT
AAGAGCAACTGCAATTTTGATTCAGGCATCTTTTCTTCCTTTGCATAATTGAATGATTTA
GAGCTCAAAGGTGATACTATTTCTAATGTATCAACCTGCACTCCTATAAATAGTAACTAT
AATAGTAATAATCTTTACAATAGCAACAATACTCATTTTAATAGTTTAAACACTTAAAAT
AATATGAATAACTCTGGTCAACTTCACTAAGCATCATACCATTCACACATTTAGAGTCCT
AATCTCACTAGCTTAAGGAGCAACAATAAAAATATAAATAATTAACATTTCAATACCAAC
TTTAGTTCATCAGATAATAGTTTCGCTAAATGCATGACAAACAGCTTAAATAAATAAAAG
TAACCTGATGATATCTTATAAAGCTAATAAAATCTTAACTCTATATCTACCCGTCTCACT
CTAGATGAAGAGCAACAAATAGAATGA


>TTHERM_00649450(protein)
MENKNQTNQNNSSFQSNDLTTLIKQDYEIRNQYCTFSNGLQQNLLYAREKILYWVLDVME
KIELSLRSIEIFVFIFELHWVKNQNSIPKQELQKLALSSLYLVIKEIENEEITVDYLNYM
CKNAYSNEEIETQIKDQMNSLPNLNFIITPSILLPAFKIQIDEEDYKTASLFVYQTYDNI
ISLNSSEILFITLKFIQTSPLINSKYEDENIKAIIKLLAPFISSSLEQLEQIVKEINEFV
EQHDDNLSEDFNFPNGSSQDIKIRKMSLECDLSMNQQKQFDGESQILNNISDNSFQDNDH
NISIEQEIKSNRANSKHLDQDIQNNKDNDFLLNIFVDKNEKNKQEEMEKPQSCSDCFYFH
KSNCNFDSGIFSSFAQLNDLELKGDTISNVSTCTPINSNYNSNNLYNSNNTHFNSLNTQN
NMNNSGQLHQASYHSHIQSPNLTSLRSNNKNINNQHFNTNFSSSDNSFAKCMTNSLNKQK
QPDDILQSQQNLNSISTRLTLDEEQQIE


>TTHERM_00649450(gene)
ATGGAAAATAAAAACTAGACTAATCAAAACAACAGCAGCTTTTAAAGCAATGACCTTACA
ACTTTAATCAAATAGGATTACGAGGTTTTATATTTAATTAATTTGAACATATCCTGATAA
ATTTTTACAATAATTTAACTCTCATCTAAACACATTTTTTATTAAAATAGATCAGAAATT
AATACTGCACTTTCAGTAATGGTCTGTAATAAAATCTACTATACGCTCGTGAAAAAATTC
TTTATTGGGTTTTAGATGTAATATTACTATTATTATTTATATGGATATACTAAAAATACG
AAACGTTTGTCACTCATTTTGTGGTTACAGTAGCATTTAAATTGAAACATTTGCAATATA
AATTGAATAGCTTTTGAGTTGTTTATTTAATTATTTATTAATTGATTGATCAAGGCTGTA
ATCAATATTTTTATAAAAACACATTTTACTCGAAAACAATTGATTTACGAGGATAGGGAA
ATTAATTATAAATACCAAAAACTTTTTTTATAACTTTTTTATGTAAACTTTTCATAGAAA
GTAGATAGAAAAAAAAGTAAATCAAAAGAATAAAATAGACATATTAACTTTAATTTTATC
GAATTAAATAATTCTTATCTCTTTTTACCATTAAAATTATTATTTAATTCTTATTTTTTC
TATTTTACTTTACAATTTTTATGGGGTATCTAAGAGACTGAAATTAAACAAATGAGCTTA
AATATTTTACTCAACTTTTAATGTATCTTAAACCACAAAACATTCAATTATTTTTCAAAT
TTATCCTTTACTTTTACAGGATTAATACATATTTTTTTACTATTGAAATCATCAGGTAAT
GGAGAAAATTGAGCTATCCTTAAGGTCGATCGAAATATTCGTCTTCATTTTTGAATTACA
TTGGGTGAAAAATTAGAATTCTATTCCTAAACAAGAGTTATAAAAGCTAGCTTTGAGCTC
CCTTTATTTAGTCATTAAGGTAGCAATTTTTTATTTAACAAAGATTAAATAAATTAATTG
AAAAATTCAAAAAATTTATTTAATATTTCCTTTTTGTTATTAGATTACTTACTAATAATT
TGATTTCTTTGGTAAAGTTGGATTTGATAAATCAAATATTCATCTTATAATTATTATAGT
AGAAATTTTAAATCAAAATCCAACATTAAAAATTAATTTTAATTGATTGCTTATCAAATT
CAATCAACTTCCCACCCTAATGGAACAAGGTTTTCAAAATTTTATTATTATAAATACCAA
ATATTTTAGATATTGTCATTACCTTTAGCAATCAATCAATAACTTGCATCGCATTTAAAA
AACACTCTTTTATTTTTTCCCATTTTACAAATAACGCTATTCTTTGGTTGAATCCTAAGT
ATTTTTTCTTTAATTCCGATTCATATTTTTGTTAAAATTTAATAAAGATTCATTTATAAA
TGCTAAATAAATATCAAATGGCTTATTTTTGATTCTGAGATACCCTTCATTTATAATTTT
AAAATAAAATTTAAACATTTAATATGATTTTATTTTATTTCTTTATGCCAAAATGCTTGA
AAAAAGATATTAAAATAGAGTTAAGATTTATCAGATTTATCTTACAAATTAAAGCATATA
ATTTTGGATTTTTAGTTAAATTTTTATTCAAGCATTTGATAAAGTTTAAAATTAAAACTG
GTTAAGACAGTGGATGAAAATATGGATTTACAAAGATAGTAAACATACCTCTTAAAAGTA
TCCAAGAATTTATAACTACTTTTTAAGAGAAAATTAATTCAATATAATTCTATAACCCTT
ACTTCGGTTGGAGGGAAGGAATTTCTTTTTTCATTTATATTTGATTTCTTAATTTTGAAA
TATTCATTACAGCTTGAATAAATGCTTAATCGGAATTTCTCATGTGTGGGAGAAAGAAGA
TACATAAACATAAATAAATATAAATTTTTTTATAAATTTAATGGAATGAATATCTTCTTT
TCAGTCAAATTAAATCAAATTATTTGAAATAGATTTGATCTTAATGACATATTTTACTTT
TAAATATTAGGAAATAGAAAATGAAGAAATAACTGTCGATTATCTAAATTATATGTGTAA
AAATGCCTATTCTAATGAAGAAATAGAAACTTAGATAAAGGATTAGATGAATTCCTTGCC
AAATCTTAATTTTATAATTACTCCATCTATTCTTTTACCAGCTTTTAAGATTTAGATTGA
CGAAGAAGACTACAAAACTGCATCACTTTTCGTTTATTAAAGTAAAAAATTTTATTTAAT
AAATAAAAACACATTTTTTGAAGCTCTAACCAGCTAAATATCTAAAGATACAATCTATTA
ATTCAATTTGATACGTTAAATAAATTTTATAATTAATTTGCATCTAAAATAAAAAAACTG
ATTAAAACTATGCTTATAGATATATTTTAATAAATTTATTAGCTTATTCAAAATCAAACA
CAAATAAAGTAACAAGTATTATGATTAGTAAGATTGTAATCAAAAAAATATATTTACAAC
CTGTTACTTAAAATAAAAGAGCAAAGGAATTCAATTTACCACAAAATTTTTTATTTTGAT
TTTTTTAATAACTAACTATTTTTTAAATATCAACCAGCTTACGATAATATTATAAGTCTG
AATTCTTCAGAAATACTTTTCATTACTCTCAAATTTATACAAACTTCTCCTCTCATAAAT
AGTAAATATGAGGACGAGAATATTAAAGCTATTATAAAATTACTTGCGCCTTTTATTTCT
TCCTCATTAGAATAGCTTGAGCAAATAGTAAAAGAAATTAATGAATTTGTAGAACAACAC
GATGATAATCTCTCTGAAGACTTTAATTTTCCTAATGGTTCCTCTTAAGACATCAAAATT
CGCAAAATGTCTTTAGAGTGCGATTTATCTATGAACTAGCAAAAATAATTTGATGGTGAA
TCTTAAATTCTTAACAATATCTCTGATAATAGCTTTTAAGACAATGATCACAACATCTCA
ATAGAGCAAGAAATAAAAAGTAATAGAGCTAATAGCAAACATCTAGATTAAGATATTTAG
AACAACAAAGACAATGACTTTTTGCTTAATATTTTTGTTGATAAAAATGAAAAAAATAAG
TAAGAAGAAATGGAAAAGCCCTAGTCTTGTAGCGATTGCTTCTATTTCCATAAGAGCAAC
TGCAATTTTGATTCAGGCATCTTTTCTTCCTTTGCATAATTGAATGATTTAGAGCTCAAA
GGTGATACTATTTCTAATGTATCAACCTGCACTCCTATAAATAGTAACTATAATAGTAAT
AATCTTTACAATAGCAACAATACTCATTTTAATAGTTTAAACACTTAAAATAATATGAAT
AACTCTGGTCAACTTCACTAAGCATCATACCATTCACACATTTAGAGTCCTAATCTCACT
AGCTTAAGGAGCAACAATAAAAATATAAATAATTAACATTTCAATACCAACTTTAGTTCA
TCAGATAATAGTTTCGCTAAATGCATGACAAACAGCTTAAATAAATAAAAGTAACCTGAT
GATATCTTATAAAGCTAATAAAATCTTAACTCTATATCTACCCGTCTCACTCTAGATGAA
GAGCAACAAATAGAATGA