Identifiers and Description

Gene Model Identifier

TTHERM_00082190

Standard Name

CYC28 (Cyclin 28)

Aliases

PreTt16265 | 6.m00339 | 3836.m01937

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00134 ) cyclin, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00082190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02363.16.999872280442742e-128hypothetical protein (264 aa)
OxytrichaContig7822.0.g323.9992896861436003e-19Cyclin, N-terminal domain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64
  2. Ref:26205990: Hayashi A, Mochizuki K (2015) Targeted Gene Disruption by Ectopic Induction of DNA Elimination in Tetrahymena. Genetics 201(1):55-64

Sequences

>TTHERM_00082190(coding)
ATGGCTGCTTTTTCAAAATTAAGAGGAGAAAAATTAATTATTATAAAGTAATAATTAATT
TTTTAACCAAAAACTATATTTTTCGTTTGTGTTTATTTGATAAATATTTAAAATAGTGCT
TGCTGTTTTATGAAAATGAACCATCATTAAAATTTTGAATAATTTTAATTTTGTTCTTAA
CTTGTATGGTCTGTTCCATCCCTCTTTGGGATTAAAGTTACAGAGTTTTTGAAGCACAAT
TTGAATGAAAAGCGTCATGAGGAATATGTAAAAAAGTCAAATATTAATATTCCAGCAGAT
TTGATTGCTTACATTTTTTAATGTTCAGAACTGCTTGAAGTAGAGACGATTGTCCATTTC
CATTCTATCCACTTATTTCACTTTTACTTAGAGAGGAATCCACATGAATTGAAGAGTGAC
TTGTAGCTAGTGTGTCTCGTTTGTCTGATGCTTTCATCGAAGTTATATGAGAAATGTTAG
ATATGTGCAGATAATATCATTTACATATCTAATTATTCATACACCAAACAAGATATCCTA
AAAACAGAAAACAAAATTTTAACTTCATTTAATTTCTAAATCACACTAAGAGATGAGCTA
TTAGTTGACAAAGTCATGATTTTTCTAAAACTACTTGACCCTCTTGTAGCCTCAAATACC
TTAGAAGTGTTCATTAAGATATCTATATAGCTAATTGAGGCCCTCTACGAAGATTTTTTG
TACATAAAGAACTTCCCAGATATGAATTTGCTATCTGCATCAATAATTTAATGTGCATCC
GTCCTTTTAACAAGACATACAGGAAATATGCCAATTATTTTAAGATTAAGCAGTTTGATA
AAGCAAAATCAATTAACAGTCTTGTAAGTTTCTCATTAAATATTTAAGAAAATCCTTAAA
AAAGAGTTTATGAAAGGATTCTCCTTTTGA


>TTHERM_00082190(protein)
MAAFSKLRGEKLIIIKQQLIFQPKTIFFVCVYLINIQNSACCFMKMNHHQNFEQFQFCSQ
LVWSVPSLFGIKVTEFLKHNLNEKRHEEYVKKSNINIPADLIAYIFQCSELLEVETIVHF
HSIHLFHFYLERNPHELKSDLQLVCLVCLMLSSKLYEKCQICADNIIYISNYSYTKQDIL
KTENKILTSFNFQITLRDELLVDKVMIFLKLLDPLVASNTLEVFIKISIQLIEALYEDFL
YIKNFPDMNLLSASIIQCASVLLTRHTGNMPIILRLSSLIKQNQLTVLQVSHQIFKKILK
KEFMKGFSF


>TTHERM_00082190(gene)
ATGGCTGCTTTTTCAAAATTAAGAGGAGAAAAATTAATTATTATAAAGTAATAATTAATT
TTTTAACCAAAAACTATATTTTTCGTTTGTGTTTATTTGATAAATATTTAAAATAGTGCT
TGCTGTTTTATGAAAATGAACCATCATTAAAATTTTGAATAATTTTAATTTTGTTCTTAA
CTTGTATGGTCTGTTCCATCCCTCTTTGGGATTAAAGTTACAGGTATCTTACCTATATTA
AACTCCAATTTTCAAAGATATTATATTTTTTTACAAATACTTCAAATTAAATATAGAGTT
TTTGAAGCACAATTTGAATGAAAAGCGTCATGAGGAATATGTAAAAAAGTCAAATATTAA
TATTCCAGCAGATTTGATTGCTTACATTTTTTAATGTTCAGAACTGCTTGAAGTAGAGAC
GATTGTCCATTTCCATTCTATCCACTTATTTCACTTTTACTTAGAGAGGAATCCACAGTA
TTTATTCATTTTCTTAATCTTTTTTAATGAAACACTTTAAATTATAGTGAATTGAAGAGT
GACTTGTAGCTAGTGTGTCTCGTTTGTCTGATGCTTTCATCGAAGGTAACTTTATAAGTA
AACATTATATTTATAATAAGACTTCTTATTAAAATTGAAAGTTATATGAGAAATGTTAGA
TATGTGCAGATAATATCATTTACATATCTAATTATTCATACACCAAACAAGGTAAACAAA
TTGAATTTAATTATCTTATAGCTATAATATTTTACTTTAAAATGATAAATACCACTAGAT
ATCCTAAAAACAGAAAACAAAAGTAAATAAATAAAAATTTAATTTAATCAACTTTTAAGT
AAGTTTAAAATTAATTTCAATAAACAGTTTTAACTTCATTTAATTTCTAAATCACACTAA
GAGATGAGCTATTAGTTGACAAAGTCATGATTTTTCTAAAACTACTTGACCCTCTTGTAG
CCTCAAATACCTTAGAAGTGTTCATTAAGATATCTATATAGCTAATTGAGGCCCTCTACG
AAGATTTTTTGTACATAAAGAACTTCCCAGATATGAATTTGCTATCTGCATCAAGTAATT
TGATTAAATTCAACATATTATTCTTAAATACTTTTTAAAATTTTTAATATATCAAGTAAT
TTAATGTGCATCCGTCCTTTTAACAAGACATACAGGAAATATGCCAATTATTTTAAGATT
AAGCAGTTTGATAAAGCAAAATCAATTAACAGTCTTGTAAGTTTCTCATTAAATATTTAA
GAAAATCCTTAAAAAAGAGTTTATGAAAGGATTCTCCTTTTGA