Identifiers and Description

Gene Model Identifier

TTHERM_000576939

Standard Name

CYC27 (Cyclin 27)

Aliases

None

Description

zinc finger C2H2 type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_000576939

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04051.15.000412888119721e-59hypothetical protein (115 aa)
DictyBaseDDB_G02866170.0000000400154582995175cycK on chromosome: 4 position
4722525 to 4724281
WormBaseWBGene000096500.00000030014504373857585locus:ccnk-1 status:Confirme
d UniProt:O17869 protein_i
d:CAB05724.2
OxytrichaContig21227.0.g1040.000009999254677478949Cyclin, N-terminal domain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_000576939(coding)
ATGAAGCTAATTGATTTATAAGAAAATGAAAGTAGTCCTACAATTATTTCTAACTAAAGA
AAATAAGTTTTAAGACAAGAAATGGTTAAATTTATGCTTTAAGCTGCTTCTCACTTGAAA
ATATCTACTAAAACTCTTGGCAAGGCACTTTATTTAGTTACTGCTTTTGATAAGATTTAT
GGGAAACATTTTGACTAAACTCTTTGCTGTATGTCAGCGATTTACTTAGCCTCTAAACTC
GATGATAATTAGCTAGAAGTAGATAATTGTATAAAATAATATACACTTTTATCTCATAAC
TAAAAAAAATATCATAGAAAACTGTCGTTTGACTAATTGGAAACAGATGATGATTAATTG
GAAATTCTGAAAATGAGTCTATTTGAAATGGAAACTGAATTACTTCTATCAATAGGTTTT
AATCTTAAAATAAGAGTTCCTCAAGAGTATTTAGAATTTTATTAGAAAAAATTTTCAAAG
TACATAGAGAAACCTATATTTGAAGCTGCTAATACTATACTTAACGATTCATATCAACTT
AATGTTTGTATAACTCACAGGCCAGACCATATAGCTATAGCGTGCTTATACATATCAATG
TCATTATTTAAAAAGGCTGATCTTTAAATCAATACTCCTAACTTAGATAAGTTCAATCTA
TGA


>TTHERM_000576939(protein)
MKLIDLQENESSPTIISNQRKQVLRQEMVKFMLQAASHLKISTKTLGKALYLVTAFDKIY
GKHFDQTLCCMSAIYLASKLDDNQLEVDNCIKQYTLLSHNQKKYHRKLSFDQLETDDDQL
EILKMSLFEMETELLLSIGFNLKIRVPQEYLEFYQKKFSKYIEKPIFEAANTILNDSYQL
NVCITHRPDHIAIACLYISMSLFKKADLQINTPNLDKFNL


>TTHERM_000576939(gene)
ATGAAGCTAATTGATTTATAAGAAAATGAAAGTAGTCCTACAATTATTTCTAACTAAAGA
AAATAAGTTTTAAGACAAGAAATGGTTAAATTTATGCTTTAAGCTGCTTCTCACTTGAAA
ATATCTACTAAAACTCTTGGCAAGGCACTTTATTTAGTTACTGCTTTTGATAAGATTTAT
GGGAAACATTTTGACTAAACTCTTTGCTGTATGTCAGCGATTTACTTAGCCTCTAAACTC
GATGATAATTAGCTAGAAGTAGATAATTGTATAAAATAATATACACTTTTATCTCATAAC
TAAAAAAAATATCATAGAAAACTGTCGTTTGACTAATTGGAAACAGATGATGATTAATTG
GAAATTCTGAAAATGAGTCTATTTGAAATGGAAACTGAATTACTTCTATCAATAGGTTTT
AATCTTAAAATAAGAGTTCCTCAAGAGTATTTAGAATTTTATTAGAAAAAATTTTCAAAG
TACATAGAGAAACCTATATTTGAAGCTGCTAATACTATACTTAACGATTCATATCAACTT
AATGTTTGTATAACTCACAGGCCAGACCATATAGCTATAGCGTGCTTATACATATCAATG
TCATTATTTAAAAAGGCTGATCTTTAAATCAATAGTAAATGTTGGATTGATTACATATTA
GTAGTAAATGATTAATTTCCATTGCATTTATTTAAAAAGCTCCTAACTTAGATAAGTTCA
ATCTATGA